ID LN889103; SV 1; linear; genomic DNA; STD; INV; 236 BP. XX AC LN889103; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus sp. ARC2629 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC2629 XX KW . XX OS Cryptorhynchus sp. ARC2629 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus; unclassified Cryptorhynchus. XX RN [1] RP 1-236 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f3235659297d4a85cc13880321c346dd. XX FH Key Location/Qualifiers FH FT source 1..236 FT /organism="Cryptorhynchus sp. ARC2629" FT /isolate="ARC2629" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736923" FT CDS <1..>236 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L107" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L107" FT /protein_id="CUR49934.1" FT /translation="GVRQLVVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWNVERKEG" XX SQ Sequence 236 BP; 73 A; 55 C; 58 G; 48 T; 2 other; ggagtaagac aacttgtcgt tggtgtcaac aaaatggact ccaccgaacc accatacagt 60 gaacccagat tcgaagaaat caagaaggaa gtatcttctt acatcaagaa aattggttac 120 aacccwgccg ctgtygcttt cgtgcccatc tctggctggc acggggacaa catgttggag 180 gcctctacca aaatgccgtg gttcaaagga tggaacgtcg aacgtaagga aggcaa 236 // ID LN889104; SV 1; linear; genomic DNA; STD; INV; 287 BP. XX AC LN889104; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Chalcodermus cf. calidus MB-2015 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC2632 XX KW . XX OS Chalcodermus cf. calidus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Sternechini; Chalcodermus. XX RN [1] RP 1-287 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fa44d19be57cdddbc1d98a38469e44c6. XX FH Key Location/Qualifiers FH FT source 1..287 FT /organism="Chalcodermus cf. calidus MB-2015" FT /isolate="ARC2632" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738344" FT CDS <1..>287 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KZE6" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZE6" FT /protein_id="CUR49935.1" FT /translation="DSTEPAYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDN FT MLEASTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLRLPL" XX SQ Sequence 287 BP; 82 A; 75 C; 59 G; 67 T; 4 other; gactcaacag arcctgcata cagtgaaagc cgttttgaag aratcaaaaa rgaagtatca 60 tcgtacatca agaagattgg ttacaaccca gccgctgtcg cctttgtacc aatctctggc 120 tggcacggag acaacatgtt ggaagcttcc accaaaatgc catggttcaa gggatggaat 180 gttgaacgta aagaaggcaa agctgarggc aagaccctta ttgatgcttt ggatgccatc 240 cttcccccat ctcgtcctac tgacaaaccc ctccgtcttc ctcttca 287 // ID LN889105; SV 1; linear; genomic DNA; STD; INV; 287 BP. XX AC LN889105; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lyterius sp. ARC2922 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC2922 XX KW . XX OS Lyterius sp. ARC2922 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Baridinae; Lyterius; unclassified Lyterius. XX RN [1] RP 1-287 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ec25df0d91851491bb0be23ce6d3c31b. XX FH Key Location/Qualifiers FH FT source 1..287 FT /organism="Lyterius sp. ARC2922" FT /isolate="ARC2922" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736980" FT CDS <1..>287 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0S8" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0S8" FT /protein_id="CUR49936.1" FT /translation="DSTEPAYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDN FT MLEASTKMPWFKGWAVERKEGKADGKTLIDALDAILPPSRPTDKPLRLPL" XX SQ Sequence 287 BP; 75 A; 86 C; 60 G; 66 T; 0 other; gactccactg aaccagctta cagcgaatcc cgtttcgaag aaatcaagaa ggaagtatct 60 tcctacatca agaagatcgg ttacaacccc gccgctgttg ctttcgtccc catctctgga 120 tggcacggag acaacatgtt ggaagcttcc accaagatgc catggttcaa gggatgggcc 180 gttgaacgta aagaaggcaa agctgacggt aaaaccctca tcgacgcttt ggacgctatc 240 cttccaccct ctcgtcctac tgacaaacct cttcgtcttc cccttca 287 // ID LN889106; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889106; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ampagia sp. ARC3408 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3408 XX KW . XX OS Ampagia sp. ARC3408 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ampagia; unclassified Ampagia. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e797369772dfbe155a92888269479ea2. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Ampagia sp. ARC3408" FT /isolate="ARC3408" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736956" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY12" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY12" FT /protein_id="CUR49937.1" FT /translation="GVKQJVVGVNKMXSTEPPYSEPRYEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLESSAKMPWFKGWAVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 99 A; 76 C; 66 G; 79 T; 3 other; ggagtaaaac aamttgtcgt cggkgttaac aaaatggamt ccactgaacc tccatacagc 60 gaacctcgat atgaagaaat caaaaaagaa gtatcgtcat acattaaaaa gattggttac 120 aacccagcgg cagttgcctt cgtacctatc tccggttggc atggggataa catgttagaa 180 tcttccgcca aaatgccttg gttcaaagga tgggctgttg aacgtaaaga aggcaaggct 240 gaaggaaaaa ctcttattga tgctttagat gccatccttc cacccagccg tcctactgac 300 aaacctctcc gtcttcctct tca 323 // ID LN889107; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889107; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ectatorrhinus alatus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3414 XX KW . XX OS Ectatorrhinus alatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Ectatorrhinus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d76b0485ec79d0e9661da35c6569d1c2. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Ectatorrhinus alatus" FT /isolate="ARC3414" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738249" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L5B2" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5B2" FT /protein_id="CUR49938.1" FT /translation="GVKQLIVGVNKMDSXEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 102 A; 65 C; 65 G; 90 T; 1 other; ggagtaaaac aacttatcgt cggtgttaac aaaatggatt ccamtgaacc accatacagt 60 gaatctcgtt ttgaagaaat caagaaagaa gtatcttcgt acattaagaa gattggttac 120 aatccagctg ctgttgcctt tgtacctatt tctggttggc atggagataa catgttggaa 180 gcttccacaa aaatgccatg gttcaaagga tggaatgttg aacgtaaaga aggaaaggct 240 gaaggaaaaa ctctcattga tgctttagat gccattcttc cacccagtcg tcctacagac 300 aaacctcttc gtcttcctct tca 323 // ID LN889108; SV 1; linear; genomic DNA; STD; INV; 203 BP. XX AC LN889108; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pinacopus sp. ARC3472 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3472 XX KW . XX OS Pinacopus sp. ARC3472 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Molytini; Pinacopus; unclassified Pinacopus. XX RN [1] RP 1-203 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1d0e5edfcf9f57823669d42831ba78d5. XX FH Key Location/Qualifiers FH FT source 1..203 FT /organism="Pinacopus sp. ARC3472" FT /isolate="ARC3472" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736996" FT CDS <1..>203 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY98" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY98" FT /protein_id="CUR49939.1" FT /translation="GVKQLVVGVNKMDSTEPPYSEARFEEIKKEVSSYIKKIGYAPAAV FT AFVPISGWHGDNMLESSSKMPW" XX SQ Sequence 203 BP; 62 A; 43 C; 45 G; 53 T; 0 other; ggagtaaaac aacttgtcgt cggtgtcaac aaaatggact ctactgaacc gccatacagt 60 gaagctcgtt tcgaagaaat caaaaaagag gtctcatctt acatcaagaa aattggttat 120 gcccctgcag ctgtcgcttt tgtaccaatt tcaggctggc atggagacaa catgttggaa 180 tcttccagta agatgccatg gtt 203 // ID LN889109; SV 1; linear; genomic DNA; STD; INV; 246 BP. XX AC LN889109; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Storeus sp. ARC3500 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3500 XX KW . XX OS Storeus sp. ARC3500 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Storeus; unclassified Storeus. XX RN [1] RP 1-246 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c376ff29179823137c86478c6fe66788. XX FH Key Location/Qualifiers FH FT source 1..246 FT /organism="Storeus sp. ARC3500" FT /isolate="ARC3500" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736950" FT CDS <1..>246 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3I0" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3I0" FT /protein_id="CUR49940.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLESSAKMPWFKGWAVERKEGKADG" XX SQ Sequence 246 BP; 81 A; 54 C; 55 G; 55 T; 1 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc accatacagc 60 gaatctcgat tcgaagaaat caaaaaggaa gtatcctcat acatyaaaaa aattggttac 120 aacccagctg ctgttgcctt cgtacccatc tctggttggc atggagacaa catgttggaa 180 tcttcagcca aaatgccctg gttcaaggga tgggctgttg aacgtaaaga aggcaaagct 240 gatggc 246 // ID LN889110; SV 1; linear; genomic DNA; STD; INV; 209 BP. XX AC LN889110; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Trachodes hispidus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3510 XX KW . XX OS Trachodes hispidus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Trachodini; Trachodes. XX RN [1] RP 1-209 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 19398757c26d30047f2248304ef68979. XX FH Key Location/Qualifiers FH FT source 1..209 FT /organism="Trachodes hispidus" FT /isolate="ARC3510" FT /mol_type="genomic DNA" FT /db_xref="taxon:202221" FT CDS <1..>209 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYS2" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYS2" FT /protein_id="CUR49941.1" FT /translation="GYNPAAVAFVPISGWHGDNMLEASSKMPWFKGWNVERKEGKAEGK FT TLIDALDAILPPSRPTDKALRLPL" XX SQ Sequence 209 BP; 51 A; 53 C; 54 G; 51 T; 0 other; ggttacaatc ccgctgctgt ggcatttgta cccatttctg gctggcacgg agacaacatg 60 ttggaggctt ccagcaagat gccatggttc aaaggatgga atgttgaacg taaagaaggc 120 aaggctgaag gaaagactct tattgacgct ttggatgcta tcctgccacc ctctcgtcct 180 accgacaaag ctctgcgtct gccactgca 209 // ID LN889111; SV 1; linear; genomic DNA; STD; INV; 179 BP. XX AC LN889111; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantorhytes huonarius partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3512 XX KW . XX OS Pantorhytes huonarius OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Entiminae; Pachyrhynchini; Pantorhytes. XX RN [1] RP 1-179 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 88bd534082bb8022b52bac9702d3deca. XX FH Key Location/Qualifiers FH FT source 1..179 FT /organism="Pantorhytes huonarius" FT /isolate="ARC3512" FT /mol_type="genomic DNA" FT /db_xref="taxon:1671690" FT CDS <1..>179 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L301" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L301" FT /protein_id="CUR49942.1" FT /translation="VNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGW FT HGDNMLEPSSKMPW" XX SQ Sequence 179 BP; 56 A; 37 C; 35 G; 51 T; 0 other; gttaataaaa tggactcgac tgaaccacca tacagcgaac cccgttttga ggaaatcaaa 60 aaagaagtat cttcttacat caagaaaatt ggttacaatc ctgcagctgt tgcctttgtt 120 cccatttctg gatggcatgg agacaatatg ttggaaccct ctagtaaaat gccttggtt 179 // ID LN889112; SV 1; linear; genomic DNA; STD; INV; 215 BP. XX AC LN889112; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ottistira dani partial Elongation factor 1-alpha gene for Elongation factor DE 1-alpha, isolate ARC3513 XX KW . XX OS Ottistira dani OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Entiminae; Celeuthetini; Ottistira. XX RN [1] RP 1-215 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9355c5c70a8cd819deb8b2817624ab67. XX FH Key Location/Qualifiers FH FT source 1..215 FT /organism="Ottistira dani" FT /isolate="ARC3513" FT /mol_type="genomic DNA" FT /db_xref="taxon:1671837" FT CDS <1..>215 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYB2" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYB2" FT /protein_id="CUR49943.1" FT /translation="KIGYNPXAVAFVPISGWHGXNMLEPSNKMPWFXGWNVERKEGKAE FT GKCLIDALDAILPPSRPTDKPLRLPL" XX SQ Sequence 215 BP; 59 A; 52 C; 45 G; 56 T; 3 other; aaaattggtt ataatccagy tgctgttgct ttcgtgccaa tctctggatg gcacggakac 60 aacatgttgg agccttccaa caaaatgcca tggttcargg gatggaatgt agaacgtaaa 120 gaaggaaaag ctgaaggaaa atgccttatt gatgccttgg atgccatttt accaccctct 180 cgtcccaccg acaaacccct tcgtcttcct cttca 215 // ID LN889113; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889113; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Imathia sp. ARC3517 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3517 XX KW . XX OS Imathia sp. ARC3517 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Imathia; unclassified Imathia. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 05b4c7297c947e407237bda77eb223f5. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Imathia sp. ARC3517" FT /isolate="ARC3517" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736976" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L197" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L197" FT /protein_id="CUR49944.1" FT /translation="GVRQLIVGVNKMDSXEPPYSEPRFEEIKKEVSSYIKKIGYNPTAV FT VFVPISGWHGDNMLESSNKMPWFKGWSIERKEGKADGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 98 A; 79 C; 62 G; 83 T; 1 other; ggagtaagac aacttatcgt cggtgttaac aaaatggatt ccaytgaacc accatacagc 60 gaaccccgtt tcgaagaaat taagaaagaa gtatcatcat acatcaaaaa gattggttac 120 aaccccactg ctgttgtttt tgtacccatc tctggttggc acggagacaa tatgttggaa 180 tcttccaaca aaatgccatg gttcaaagga tggtctattg aacgtaagga aggcaaagct 240 gatggaaaaa ccctcatcga tgctttggac gccattcttc caccctctcg tcctacagac 300 aagcctctcc gtcttcctct tca 323 // ID LN889114; SV 1; linear; genomic DNA; STD; INV; 194 BP. XX AC LN889114; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pseuderodiscus sp. ARC3519 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3519 XX KW . XX OS Pseuderodiscus sp. ARC3519 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Erodiscini; Pseuderodiscus; unclassified Pseuderodiscus. XX RN [1] RP 1-194 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6206d63e768547ab39c4b1e992be0e43. XX FH Key Location/Qualifiers FH FT source 1..194 FT /organism="Pseuderodiscus sp. ARC3519" FT /isolate="ARC3519" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737004" FT CDS <1..>194 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0M1" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0M1" FT /protein_id="CUR49945.1" FT /translation="XVAFVPISGWHGDNMLETSSKMPWFKGWNVERKEGKAEGKTLIDA FT LDAILPPSRPTDKPLRLPL" XX SQ Sequence 194 BP; 47 A; 50 C; 49 G; 47 T; 1 other; gytgtggctt tcgtaccaat ttctggctgg catggggaca acatgttgga gacctccagc 60 aagatgccat ggttcaaggg atggaacgtc gaacgtaaag aaggcaaggc tgaaggaaag 120 actcttattg atgctttgga tgctatcctg ccaccctctc gtcccaccga caaacctctg 180 cgtcttccac ttca 194 // ID LN889115; SV 1; linear; genomic DNA; STD; INV; 224 BP. XX AC LN889115; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ochronanus sp. ARC3525 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3525 XX KW . XX OS Ochronanus sp. ARC3525 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cossoninae; Ochronanus; unclassified Ochronanus. XX RN [1] RP 1-224 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7e84a415589182aabd3ab91a789d0775. XX FH Key Location/Qualifiers FH FT source 1..224 FT /organism="Ochronanus sp. ARC3525" FT /isolate="ARC3525" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736988" FT CDS <1..>224 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0V4" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0V4" FT /protein_id="CUR49946.1" FT /translation="YIKKIGYNPAAVAFVPISGWHGDNMLETSSKMPWFKGWAVDRKEG FT KAEGKTLIDALDAILPPARPTDKPLRLPL" XX SQ Sequence 224 BP; 63 A; 54 C; 49 G; 58 T; 0 other; tacatcaaaa agattggtta caatcctgct gccgttgctt tcgtgccaat atctggatgg 60 catggtgaca acatgttgga aacgtccagt aaaatgccat ggttcaaggg atgggctgtt 120 gaccgtaaag aaggaaaagc tgaaggaaaa acccttattg atgctctgga tgccattcta 180 ccacctgctc gccctacaga caaacctctt cgtcttccac ttca 224 // ID LN889116; SV 1; linear; genomic DNA; STD; INV; 197 BP. XX AC LN889116; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Gloeodema sp. ARC3527 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3527 XX KW . XX OS Gloeodema sp. ARC3527 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cossoninae; Gloeodema; unclassified Gloeodema. XX RN [1] RP 1-197 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 30f5b0e582039c54b4b7e154a14838d7. XX FH Key Location/Qualifiers FH FT source 1..197 FT /organism="Gloeodema sp. ARC3527" FT /isolate="ARC3527" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736972" FT CDS <1..>197 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3A0" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3A0" FT /protein_id="CUR49947.1" FT /translation="KQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAF FT VPISGWHGDNMLEPSTKMPW" XX SQ Sequence 197 BP; 61 A; 46 C; 37 G; 53 T; 0 other; aaacaactta tcgtcggtgt caacaaaatg gactccactg aaccaccata cagcgaatcc 60 cgtttcgaag aaatcaagaa agaagtgtct tcttacatca agaaaattgg ttataaccca 120 gctgctgttg cttttgtacc catttctggt tggcacggag acaatatgtt ggaaccttcc 180 accaaaatgc cttggtt 197 // ID LN889117; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889117; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ipsichora longipes partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3528 XX KW . XX OS Ipsichora longipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Baridinae; Ipsichora. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 83c226a9ad3bb964990a4758bfd5ce1d. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Ipsichora longipes" FT /isolate="ARC3528" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738255" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY54" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY54" FT /protein_id="CUR49948.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWAIERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 93 A; 90 C; 69 G; 71 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaat aaaatggact ctacagaacc accatacagt 60 gaatcccgtt tcgaagaaat caagaaagaa gtgtcttcct acatcaagaa gatcggttac 120 aatcccgccg ccgttgcttt cgttcccatc tccggatggc acggagacaa catgttggaa 180 gcttccacca agatgccatg gttcaaggga tgggccattg aacgtaaaga gggcaaagct 240 gaaggaaaga ccctcattga tgctttggat gccatcctcc caccatcccg tcctaccgac 300 aagcctcttc gtctcccact cca 323 // ID LN889118; SV 1; linear; genomic DNA; STD; INV; 191 BP. XX AC LN889118; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Kyklioacalles roboris partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3531 XX KW . XX OS Kyklioacalles roboris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Kyklioacalles. XX RN [1] RP 1-191 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3defa8992afb53bf184ed628535b69ef. XX FH Key Location/Qualifiers FH FT source 1..191 FT /organism="Kyklioacalles roboris" FT /isolate="ARC3531" FT /mol_type="genomic DNA" FT /db_xref="taxon:501664" FT CDS <1..>191 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0V7" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0V7" FT /protein_id="CUR49949.1" FT /translation="VAFVPISGWHGDNMLEASAKMPWFKGWNVDRKEGKAEGKTLIDAL FT DAILPPSRPTDKPLRLPL" XX SQ Sequence 191 BP; 46 A; 50 C; 41 G; 53 T; 1 other; gttgcctttg tacccatctc tggttggcat ggagacaaca tgttggaagc ttctgccaaa 60 atgccatggt ttaarggatg gaacgttgac cgtaaagaag gtaaagctga aggaaagacc 120 cttattgatg ctttggatgc catccttcca ccttctcgcc ctactgacaa acctctccgt 180 cttccccttc a 191 // ID LN889119; SV 1; linear; genomic DNA; STD; INV; 203 BP. XX AC LN889119; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles cf. hustachei MB-2015 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3532 XX KW . XX OS Acalles cf. hustachei MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles. XX RN [1] RP 1-203 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7a4dc7a833313a82781ec72fd1dc90b1. XX FH Key Location/Qualifiers FH FT source 1..203 FT /organism="Acalles cf. hustachei MB-2015" FT /isolate="ARC3532" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738338" FT CDS <1..>203 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L125" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L125" FT /protein_id="CUR49950.1" FT /translation="GVRQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT VFVPISGWHGDNMLEPSNKMPW" XX SQ Sequence 203 BP; 63 A; 37 C; 45 G; 58 T; 0 other; ggagtgagac aacttattgt tggtgttaat aaaatggact ctactgaacc accatacagt 60 gaaagccgtt ttgaagaaat caagaaagaa gtatcatcct acatcaagaa gattggttat 120 aatccagctg ctgttgtctt tgtacctatc tctggttggc acggggataa catgttggag 180 ccttccaaca aaatgccatg gtt 203 // ID LN889120; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889120; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ithystenus sp. ARC3538 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3538 XX KW . XX OS Ithystenus sp. ARC3538 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Brentidae; OC Trachelizinae; Ithystenus; unclassified Ithystenus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6f6bd8d008aceea537d53a858bbdd8c5. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Ithystenus sp. ARC3538" FT /isolate="ARC3538" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736945" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KZG0" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZG0" FT /protein_id="CUR49951.1" FT /translation="GVKQLIVGVNKMDSTEPPYGEARFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSSKMPWFKGWNVERKEGKAEGKTLIEALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 87 A; 82 C; 79 G; 75 T; 0 other; ggagtaaaac aacttatcgt cggtgttaac aaaatggatt caaccgagcc cccgtacggc 60 gaagctcgtt tcgaggaaat caagaaagaa gtgtcttcat acatcaagaa gatcggttac 120 aaccctgcag ctgttgcttt cgtgcccatt tccggatggc atggggacaa catgttggaa 180 ccgtcgagca agatgccttg gtttaaagga tggaacgtcg aacgcaagga aggcaaggct 240 gaaggcaaga cccttatcga agctttggat gccattctgc cgccctctcg tcctaccgat 300 aaacctcttc gtcttcctct cca 323 // ID LN889121; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889121; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3775 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3775 XX KW . XX OS Cryptorhynchini gen. sp. ARC3775 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6db4e0f6b226d981cede5ebce638b16b. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Cryptorhynchini gen. sp. ARC3775" FT /isolate="ARC3775" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742679" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0U5" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0U5" FT /protein_id="CUR49952.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEPRYEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSNKMPWFKGWKVERKEGNAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 101 A; 76 C; 66 G; 80 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc accatacagc 60 gaacctcgtt atgaagaaat taagaaagaa gtatcgtcat atatcaaaaa gattggttac 120 aacccagctg ctgttgcttt cgtacctatc tctggttggc acggagataa catgttggag 180 ccttccaaca aaatgccatg gttcaaagga tggaaagttg aacgtaaaga aggcaatgct 240 gaaggaaaga cccttattga cgctttggat gccattttac caccatctcg tcctactgac 300 aagccgctcc gtcttcctct cca 323 // ID LN889122; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889122; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neodecilaus picus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3780 XX KW . XX OS Neodecilaus picus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Neodecilaus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 453114ee13954c0e9fab60edf4a8930c. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Neodecilaus picus" FT /isolate="ARC3780" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738257" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY27" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY27" FT /protein_id="CUR49953.1" FT /translation="GVRQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT VFVPISGWHGDNMLEPSSKMPWFKGWSIERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 95 A; 75 C; 70 G; 82 T; 1 other; ggagtaagac aacttatygt cggtgtcaac aaaatggact ctactgaacc accatacagt 60 gagcctcgtt tcgaggaaat caagaaagaa gtatcttcct atatcaaaaa gattggttac 120 aatccggctg ctgttgtttt cgtacccatc tcaggttggc acggagataa catgttggaa 180 ccttccagca aaatgccatg gttcaaagga tggagtatcg aacgtaaaga aggcaaggct 240 gagggaaaaa ctcttatcga tgctttggat gccattcttc cacctagtcg tcccaccgac 300 aaacctcttc gtcttcctct gca 323 // ID LN889123; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889123; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Blepiarda undulata partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3781 XX KW . XX OS Blepiarda undulata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Blepiarda. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6c1cb1e7fc24c2e5f1525abc706f1ead. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Blepiarda undulata" FT /isolate="ARC3781" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738232" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L5D2" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5D2" FT /protein_id="CUR49954.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLX FT LPL" XX SQ Sequence 323 BP; 94 A; 78 C; 69 G; 80 T; 2 other; ggagtaaaac aacttatcgt cggtgtcaat aaaatggact ctactgaacc accttacagc 60 gaagctcgtt ttgaggaaat taagaaagaa gtatcctcgt acatcaaaaa gattggttac 120 aatcccgctg ctgttgcctt tgtacccatc tcaggatggc acggagataa catgttggag 180 ccttccacca aaatgccatg gttcaaggga tggaatgttg aacgtaagga aggcaaggct 240 gaaggaaaga cccttattga cgcyttggat gccattcttc cacccagtcg tcctaccgac 300 aaacctcttc rtcttcctct cca 323 // ID LN889124; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889124; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Gymnoporopterus pictipes partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3782 XX KW . XX OS Gymnoporopterus pictipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Gymnoporopterus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ca7482c97e2c098460e7f0c775a3718e. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Gymnoporopterus pictipes" FT /isolate="ARC3782" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738251" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYB9" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYB9" FT /protein_id="CUR49955.1" FT /translation="GVRQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT VFVPISGWHGDNMLEPSAKMPWFKGWKVERKEGNAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 73 C; 71 G; 85 T; 0 other; ggagtcaggc aacttattgt cggtgtcaac aaaatggatt ccacagaacc accatacagt 60 gaacctcgtt tcgaggaaat taaaaaggaa gtatcatctt atatcaaaaa gatcggttac 120 aatccagctg ctgttgtttt cgttcccatc tccggatggc atggggataa tatgttggag 180 ccttccgcca aaatgccatg gttcaaggga tggaaagttg agcgcaaaga aggaaatgct 240 gaaggaaaaa ctttgattga tgctttggat gccattcttc ctcccagtcg tcctacagac 300 aaaccccttc gtcttcctct cca 323 // ID LN889125; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889125; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dysopirhinus cf grandis MB-2015 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3784 XX KW . XX OS Dysopirhinus cf grandis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Dysopirhinus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4550547d67fcc18a3a28557ddb117695. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Dysopirhinus cf grandis MB-2015" FT /isolate="ARC3784" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738347" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3K0" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3K0" FT /protein_id="CUR49956.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASSKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 95 A; 80 C; 70 G; 78 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ctaccgaacc accatacagc 60 gaaccccgtt tcgaggaaat taagaaagaa gtatcttcat acatcaaaaa gattggttac 120 aatccagctg ccgttgcctt cgttcccatc tctggttggc atggagataa catgttagag 180 gcttccagca agatgccatg gttcaaagga tggaatgttg aacgtaaaga gggcaaagct 240 gaaggaaaga ctttgattga tgctttggat gccatccttc cgcccagtcg ccccactgac 300 aaacctctcc gtcttcctct cca 323 // ID LN889126; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889126; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pteroporopterus cf. lacunosus MB-2015 partial Elongation factor 1-alpha DE gene for Elongation factor 1-alpha, isolate ARC3785 XX KW . XX OS Pteroporopterus cf. lacunosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pteroporopterus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 73a586fd4600df8b8b1f2441563dc43a. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Pteroporopterus cf. lacunosus MB-2015" FT /isolate="ARC3785" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738365" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYX7" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYX7" FT /protein_id="CUR49957.1" FT /translation="GVKQLVVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSSKMPWFKGWNVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 80 C; 71 G; 77 T; 1 other; ggagtaaaac aacttgtggt tggtgtcaac aaaatggact ctaccgaacc accatacagc 60 gaatctcgtt ttgaggaaat caagaaagaa gtatcgtcat acatcaaaaa gattggttac 120 aatccagctg ctgtcgcctt cgttccaatt tctggctggc acggagacaa catgttggag 180 ccatccagca aaatgccatg gttcaaggga tggaatgttg accgcaaaga gggcaaggct 240 gaaggaaaga ccctcattga tgctttagat gccatccttc ctcccagtcg tcctacagac 300 aaacctcttc gtcttcctct ccw 323 // ID LN889127; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889127; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Hypsophorus dromedarius partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3786 XX KW . XX OS Hypsophorus dromedarius OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Hypsophorus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b14db94a8658af6685cb9db04afd4e07. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Hypsophorus dromedarius" FT /isolate="ARC3786" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738294" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L322" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L322" FT /protein_id="CUR49958.1" FT /translation="GVKQLVVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASSKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 95 A; 78 C; 71 G; 79 T; 0 other; ggagtaaaac aacttgtcgt cggtgtcaac aaaatggact ctactgaacc gccatacagt 60 gaatcccgtt tcgaggaaat taagaaagaa gtatcttcat acatcaaaaa gatcggttac 120 aatccagctg ctgttgcctt cgttcccatc tctggttggc acggagataa catgttagag 180 gcttccagca aaatgccatg gttcaaagga tggaatgttg aacgtaaaga aggcaaggct 240 gaaggaaaga cgctgatcga tgctttggat gccatccttc cacccagtcg tcctactgac 300 aaacctctcc gtcttcctct cca 323 // ID LN889128; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889128; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Salcus elevatus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3788 XX KW . XX OS Salcus elevatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Salcus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e7bd0f6c4f32f5ed2b4f2c904f84db92. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Salcus elevatus" FT /isolate="ARC3788" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738282" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYF3" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYF3" FT /protein_id="CUR49959.1" FT /translation="GVKQLIVGVNKMDSTEPQYSEARFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWAVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 93 A; 76 C; 69 G; 85 T; 0 other; ggagtaaaac aacttatcgt cggtgttaac aaaatggact ctactgaacc acaatacagc 60 gaagctcgtt tcgaggaaat taagaaagaa gtttcttcct acatcaaaaa gattggttac 120 aacccagctg ctgttgcttt cgtacctatc tctggttggc atggagataa catgttggag 180 ccttccacca aaatgccatg gttcaaggga tgggctgttg accgtaaaga aggcaaagct 240 gaaggaaaga cacttattga tgctttggat gccatccttc cacccagtcg tcctactgac 300 aagcctctcc gtcttcctct tca 323 // ID LN889129; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889129; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus sphacelatus partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3791 XX KW . XX OS Poropterus sphacelatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1a35118631f8798eaec89c7ca72097fa. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Poropterus sphacelatus" FT /isolate="ARC3791" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738277" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L1B9" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1B9" FT /protein_id="CUR49960.1" FT /translation="GVKQLVVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSSKMPWFKGWAVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 93 A; 83 C; 72 G; 75 T; 0 other; ggagtgaaac aacttgttgt cggtgtcaac aaaatggact ccaccgaacc accatacagc 60 gaaccgcgtt ttgaagaaat taaaaaagaa gtctcgtcat acatcaaaaa gatcggttac 120 aatccagcgg cagtcgcttt cgtacccatc tctggttggc acggtgataa catgttggag 180 ccttcgagca aaatgccatg gttcaaagga tgggctgttg aacgtaaaga aggcaaagct 240 gaaggcaaga cccttattga tgctttggat gccatccttc cacccagtcg tcctactgac 300 aagccccttc gtcttcccct cca 323 // ID LN889130; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889130; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tamphilus amplicollis partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3795 XX KW . XX OS Tamphilus amplicollis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tamphilus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f2cfa2f0860d20ec3e6343b2fb9929f1. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Tamphilus amplicollis" FT /isolate="ARC3795" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738287" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0N4" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0N4" FT /protein_id="CUR49961.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWAVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 75 C; 68 G; 86 T; 0 other; ggagtaaaac aacttatcgt cggtgttaac aaaatggact ctactgaacc accatatagc 60 gaagctcgtt ttgaggaaat caaaaaagaa gtatcttcct acatcaaaaa gattggttac 120 aacccagctg ctgttgcttt cgtacctatc tctggttggc acggagataa catgttggag 180 gcttccacca aaatgccatg gttcaaggga tgggctgttg atcgtaaaga aggcaaagct 240 gaaggaaaga ctcttattga tgctttggat gccatccttc ctcccagtcg tcctacagac 300 aaacctcttc gtcttcctct cca 323 // ID LN889131; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889131; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Genuacalles sp. ARC3823 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3823 XX KW . XX OS Genuacalles sp. ARC3823 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Genuacalles; unclassified Genuacalles. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3c4ad48c619710735455dcaa94f26c8d. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Genuacalles sp. ARC3823" FT /isolate="ARC3823" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736970" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0X3" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0X3" FT /protein_id="CUR49962.1" FT /translation="GVKQLVVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSGKMPWFKGWNVERKEGKAEGKTLIEALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 92 A; 77 C; 70 G; 84 T; 0 other; ggagtaaaac aacttgtcgt tggtgtcaac aaaatggatt ccactgaacc accatacagc 60 gaaccccgtt tcgaagaaat taagaaggaa gtttcctcat acatcaagaa gattggttac 120 aatccagctg ctgttgcctt cgttcccatc tctggttggc atggggataa catgttggaa 180 ccttccggta aaatgccatg gttcaaagga tggaatgttg agcgtaaaga aggcaaggct 240 gaaggaaaga ccctcattga agctttggat gccattcttc caccatctcg tcctactgac 300 aaacctcttc gtcttcctct cca 323 // ID LN889132; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889132; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Decilaus sp. ARC3830 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3830 XX KW . XX OS Decilaus sp. ARC3830 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Decilaus; unclassified Decilaus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e35c41cc116f2a8f5e16cc9927209195. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Decilaus sp. ARC3830" FT /isolate="ARC3830" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736924" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3B7" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3B7" FT /protein_id="CUR49963.1" FT /translation="GVKQLVVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLETSSKMPWFKGWNVERKEGKAEGKTLIEALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 97 A; 78 C; 68 G; 80 T; 0 other; ggagttaaac aacttgtcgt cggtgtcaac aaaatggact ccactgaacc accatacagc 60 gaaccccgtt ttgaggaaat taagaaagaa gtatcttcat acatcaaaaa gattggttat 120 aacccagctg ctgttgcctt cgtacctatc tccggttggc acggagataa catgttggag 180 acttccagta aaatgccatg gttcaaagga tggaacgttg aacgtaaaga aggcaaggct 240 gaaggaaaga cccttattga agctttggat gccatccttc cacctagtcg tcctactgac 300 aaacctcttc gtcttcccct cca 323 // ID LN889133; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889133; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Roptoperus sp. ARC3834 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3834 XX KW . XX OS Roptoperus sp. ARC3834 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Roptoperus; unclassified Roptoperus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c532ec7e09fd250417d178b36f99f532. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Roptoperus sp. ARC3834" FT /isolate="ARC3834" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737038" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY72" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY72" FT /protein_id="CUR49964.1" FT /translation="GVRQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPTAV FT VFVPISGWHGDNMLEPSSKMPWFKGWSVERKEGKAEGKTLIDALDAILPPSRPTDKALR FT LPL" XX SQ Sequence 323 BP; 94 A; 84 C; 74 G; 71 T; 0 other; ggagtaagac aacttatcgt cggcgtcaac aaaatggact ctaccgaacc accatacagc 60 gaaagtcgtt tcgaagaaat caaaaaagaa gtgtcctcat acatcaagaa gatcggttac 120 aacccaactg ccgtcgtctt tgtacccatt tccggatggc acggagataa catgttggag 180 ccctccagca aaatgccatg gttcaaggga tggagcgttg agcgtaaaga aggcaaggct 240 gaaggaaaga ctctgattga tgctttggat gccattctcc caccgtctcg tcctaccgac 300 aaggccctcc gtcttcctct tca 323 // ID LN889134; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889134; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neomystocis squamiventris partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3849 XX KW . XX OS Neomystocis squamiventris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Neomystocis. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3ac6bc8f161bb88476d2917eefd1fe44. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Neomystocis squamiventris" FT /isolate="ARC3849" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738259" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0X2" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0X2" FT /protein_id="CUR49965.1" FT /translation="GVRQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYTPAAV FT VFVPISGWHGDNMLEPSSKMPWFKGWTVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 95 A; 78 C; 72 G; 78 T; 0 other; ggagtaagac agcttatagt tggtgtcaac aaaatggact ccactgagcc accatacagt 60 gaatcccgtt ttgaggaaat taagaaagag gtatcgtcat acatcaaaaa gattggttac 120 actccagctg ctgttgtctt cgtacccatc tctggttggc atggagacaa catgttggag 180 ccctccagca aaatgccatg gttcaaagga tggactgttg aacgcaaaga aggaaaagca 240 gaaggaaaga cactcatcga cgctttggat gccattcttc cacccagtcg tcctactgat 300 aagcctcttc gtcttcccct cca 323 // ID LN889135; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889135; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Melanterius aratus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3853 XX KW . XX OS Melanterius aratus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Melanterius. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 226afa026ce9abe1848af4d0d418f51f. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Melanterius aratus" FT /isolate="ARC3853" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738316" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L141" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L141" FT /protein_id="CUR49966.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPARPTDKPLR FT LPL" XX SQ Sequence 323 BP; 96 A; 81 C; 68 G; 78 T; 0 other; ggggtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc gccatacagc 60 gaatcccgtt ttgaagaaat caagaaggaa gtatcttcat acatcaagaa gattggttac 120 aacccagccg ctgttgcctt cgtacctatc tctggttggc atggagacaa catgttggaa 180 gcttccacca aaatgccatg gttcaaagga tggaatgttg aacgtaaaga aggaaaagct 240 gaaggaaaga ctctcattga tgctttggat gccatccttc cacctgctcg tcccaccgac 300 aaacctcttc gtcttcctct cca 323 // ID LN889136; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889136; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tyrtaeosus lateralis partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3855 XX KW . XX OS Tyrtaeosus lateralis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tyrtaeosus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c1f6572da14f69e122a500d6e8ebcedf. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Tyrtaeosus lateralis" FT /isolate="ARC3855" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738216" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KZH6" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZH6" FT /protein_id="CUR49967.1" FT /translation="GVKQLVVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSSKMPWFKGWNVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 90 A; 76 C; 70 G; 87 T; 0 other; ggagtaaagc aacttgtcgt tggtgtcaat aaaatggact ctactgaacc accttacagc 60 gaacctcgtt tcgaggaaat caagaaagaa gtttcatctt atattaaaaa gatcggttac 120 aaccccgctg ctgttgcctt cgtacccatc tctggttggc atggggataa catgttggag 180 ccttccagta aaatgccatg gttcaaagga tggaatgttg atcgtaaaga aggcaaggct 240 gaaggaaaga cccttattga tgctttggat gccatccttc cacccagtcg tcctactgac 300 aaacctcttc gtcttcctct cca 323 // ID LN889137; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889137; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acrotychreus fasciculatus partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3865 XX KW . XX OS Acrotychreus fasciculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acrotychreus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a7322156593549c548969f03694a2c39. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Acrotychreus fasciculatus" FT /isolate="ARC3865" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738220" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0W7" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0W7" FT /protein_id="CUR49968.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWAVDRKEGKADGKTLIDALDAILPPSRPTDKALR FT LPL" XX SQ Sequence 323 BP; 93 A; 76 C; 66 G; 88 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaat aaaatggact ctactgaacc accgtacagc 60 gaacctcgtt ttgaagaaat caaaaaagaa gtttcttcct acatcaaaaa aattggttac 120 aatccagctg ctgttgcttt cgtacctatc tctggatggc acggagataa catgttggag 180 ccttccacca aaatgccttg gttcaaggga tgggctgttg accgtaaaga aggcaaagct 240 gatggaaaga ctcttattga tgctttagat gccatccttc cacctagtcg tcctactgac 300 aaggctcttc gtcttcctct cca 323 // ID LN889138; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889138; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tropidotasia sp. ARC3866 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3866 XX KW . XX OS Tropidotasia sp. ARC3866 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Gasterocercini; Tropidotasia; unclassified Tropidotasia. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cf196abfc88a6ca21919f68eef9e327f. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Tropidotasia sp. ARC3866" FT /isolate="ARC3866" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737020" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY41" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY41" FT /protein_id="CUR49969.1" FT /translation="GVRQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT VFVPISGWHGDNMLESSSKMPWFKGWSIERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 70 C; 70 G; 89 T; 0 other; ggagtaagac aacttatcgt cggtgtcaac aaaatggact ctactgaacc accatacagc 60 gaacctcgtt ttgaggaaat taagaaagaa gtttcttcct acatcaagaa gattggttac 120 aatccagctg ctgttgtctt tgtacctatt tctggatggc atggggataa catgttagag 180 tcctccagca aaatgccatg gtttaaggga tggagtattg aacgtaaaga aggcaaggct 240 gaaggaaaga ctcttattga tgctttggat gccatccttc cacctagtcg tcccactgac 300 aaacctcttc gtcttccact tca 323 // ID LN889139; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889139; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinidotasia edentata partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3875 XX KW . XX OS Rhinidotasia edentata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Rhinidotasia. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 81a90cd434fe55842e3b2654c6e3cdd7. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Rhinidotasia edentata" FT /isolate="ARC3875" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738280" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L5E7" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5E7" FT /protein_id="CUR49970.1" FT /translation="GVKQLIVGVNKMDNTEPPYSEARFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWAVERKEGKADGKCLIEALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 92 A; 79 C; 71 G; 81 T; 0 other; ggggtaaaac aacttatcgt cggtgtcaac aaaatggaca acactgaacc accatacagt 60 gaagcccgtt tcgaagaaat caagaaggaa gtctcctcat acattaagaa gattggttac 120 aatccagctg ctgttgcctt cgtacctatc tctggttggc atggagacaa catgttggaa 180 ccttccacca aaatgccttg gttcaaggga tgggctgttg aacgtaaaga aggcaaagct 240 gacggaaagt gccttattga ggctttggat gccattcttc cacccagtcg tcccactgac 300 aaacctcttc gtcttcctct tca 323 // ID LN889140; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889140; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Echinodera hypocrita partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3900 XX KW . XX OS Echinodera hypocrita OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Echinodera; Ruteria. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8021f26b056ff208a3374b5f236a1e64. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Echinodera hypocrita" FT /isolate="ARC3900" FT /mol_type="genomic DNA" FT /db_xref="taxon:501686" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYD6" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYD6" FT /protein_id="CUR49971.1" FT /translation="GVRQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT VFVPISGWHGDNMLESSSKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 96 A; 76 C; 69 G; 82 T; 0 other; ggagtacgac aacttatcgt tggtgtcaac aaaatggatt ccactgaacc accctacagc 60 gaacctcgtt ttgaagaaat caagaaagaa gtatcttcat acatcaagaa aattggatac 120 aatccagctg ctgttgtttt tgtgccaatc tctgggtggc atggagacaa catgttggaa 180 tcttccagca aaatgccatg gttcaaagga tggaatgttg aacgtaaaga agggaaggcc 240 gaaggaaaga cgctcattga cgctttggat gccatccttc ctccctctcg tcctaccgac 300 aaaccccttc gtcttccttt aca 323 // ID LN889141; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889141; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Adexius scrobipennis partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3901 XX KW . XX OS Adexius scrobipennis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Molytini; Adexius. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7181b6a997a138134c5423fd27527623. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Adexius scrobipennis" FT /isolate="ARC3901" FT /mol_type="genomic DNA" FT /db_xref="taxon:501689" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3M1" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3M1" FT /protein_id="CUR49972.1" FT /translation="GVRQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAGV FT VFVPISGWHGDNMLETSSKMPWFKGWSVERKEGKAEGKTLIEALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 97 A; 72 C; 70 G; 84 T; 0 other; ggagtaagac aacttatcgt tggtgtcaac aaaatggatt ccactgaacc accttacagc 60 gaacctcgtt ttgaagaaat taaaaaggaa gtctcgtcat acattaaaaa gattggttac 120 aacccagctg gtgtcgtctt tgtacccatc tctggctggc acggagacaa tatgttggaa 180 acttccagca aaatgccatg gtttaaggga tggagtgttg aacgtaaaga aggcaaagct 240 gaaggaaaga cgcttattga agctttggat gccatccttc caccttctcg tcctactgac 300 aaacctcttc gtcttccact gca 323 // ID LN889142; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889142; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles lemur partial Elongation factor 1-alpha gene for Elongation factor DE 1-alpha, isolate ARC3902 XX KW . XX OS Acalles lemur OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 78734064119416665da18506be1862a4. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Acalles lemur" FT /isolate="ARC3902" FT /mol_type="genomic DNA" FT /db_xref="taxon:501598" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYZ8" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYZ8" FT /protein_id="CUR49973.1" FT /translation="GVXQLVVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLETSSKMPWFKGWNVDRKEGXAEGKTLIXALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 80 C; 67 G; 73 T; 9 other; ggagtaarac aactcgtcgt cggtgtcaat aaaatggact ccactgaacc accatacagc 60 gaacctcgtt tcgaagaaat maaaaaagaa gtatcctcyt acatyaagaa aattggttac 120 aatccagctg ccgttgcttt cgtaccaatc tctggatggc ayggggacaa catgttggaa 180 acttccagca aaatgccatg gttcaaggga tggaatgtkg accgtaaaga aggcarggct 240 gaaggaaaga ccctcattga wgctttggat gccattcttc ctccstctcg gcctaccgac 300 aaaccccttc gtcttcccct tca 323 // ID LN889143; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889143; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhynchaenus fagi partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3904 XX KW . XX OS Rhynchaenus fagi OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Rhynchaeninae; Rhynchaenus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 45b40062e07e2fe5cf03448428b0cb61. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Rhynchaenus fagi" FT /isolate="ARC3904" FT /mol_type="genomic DNA" FT /db_xref="taxon:202177" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L338" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L338" FT /protein_id="CUR49974.1" FT /translation="GVKQLIVGVNKMDSTEPAYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWAVERKEGKADGKCLIEALDAILPPSRPTDKALR FT LPL" XX SQ Sequence 323 BP; 88 A; 86 C; 74 G; 75 T; 0 other; ggagtaaaac aacttatcgt tggtgtcaac aagatggact ccaccgaacc agcttacagc 60 gaaagccgtt tcgaagaaat caagaaggaa gtgtcttctt acatcaagaa aatcggttac 120 aaccccgcag ctgttgcttt cgtccccatc tcaggatggc acggagacaa catgttggag 180 ccttccacca agatgccctg gttcaaggga tgggctgttg aacgtaaaga aggaaaggct 240 gacggcaagt gcctcatcga agctttggat gctatccttc ctccttcccg tcctactgac 300 aaagctcttc gtcttccact cca 323 // ID LN889144; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889144; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Anthonomus rectirostris partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3905 XX KW . XX OS Anthonomus rectirostris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Anthonomini; Anthonomus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c2ff59e5dcf8775b4a9ea66e62262e97. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Anthonomus rectirostris" FT /isolate="ARC3905" FT /mol_type="genomic DNA" FT /db_xref="taxon:1341944" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYG4" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYG4" FT /protein_id="CUR49975.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNASAV FT AFVPISGWHGDNMLEPSSKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKALR FT LPL" XX SQ Sequence 323 BP; 96 A; 77 C; 71 G; 79 T; 0 other; ggagtaaaac aacttatcgt tggtgtcaac aaaatggact cgactgaacc accatacagt 60 gaatcccgtt ttgaggaaat caagaaagaa gtatcttcat acatcaagaa gattggttac 120 aacgcaagtg ctgttgcctt tgtacccatc tctggatggc atggggacaa catgttggaa 180 ccttcctcca agatgccatg gttcaaggga tggaatgttg aacgtaaaga aggcaaagct 240 gaaggcaaga ccctgattga tgctttggat gctatcctcc caccctcacg tcctactgac 300 aaagccctcc gtcttccact tca 323 // ID LN889145; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889145; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Curculio glandium partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3907 XX KW . XX OS Curculio glandium OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Curculionini; Curculio. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 37d87254d7b5e1e0377ba4610b8d8647. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Curculio glandium" FT /isolate="ARC3907" FT /mol_type="genomic DNA" FT /db_xref="taxon:197013" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L1D5" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1D5" FT /protein_id="CUR49976.1" FT /translation="GVKQLIVGVNKMDSTEPAYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWNVERKEGKAEGKTLIEALDAILPPSRPTDKALR FT LPL" XX SQ Sequence 323 BP; 101 A; 77 C; 70 G; 75 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggatt ccactgagcc agcatacagt 60 gaatctcgtt tcgaagaaat caagaaggaa gtatcttcat acatcaagaa gattggttac 120 aacccagcag ctgttgcttt cgtacccatc tctggttggc acggagacaa catgttggag 180 ccttccacaa aaatgccatg gttcaaggga tggaatgttg aacgtaaaga aggaaaagct 240 gaaggaaaga cccttattga agctttggat gccatccttc caccaagtcg tcccaccgac 300 aaagccctac gtcttcctct cca 323 // ID LN889146; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889146; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Magdalis ruficornis partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3908 XX KW . XX OS Magdalis ruficornis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Magdalinae; Magdalis. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7f2f2c1117c5440a33dc0f8bfb957d53. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Magdalis ruficornis" FT /isolate="ARC3908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1342046" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0Q5" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0Q5" FT /protein_id="CUR49977.1" FT /translation="GVKQLVVGVNKMDSTEPPYSENRFDEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLESSAKMPWFKGWNVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 79 C; 67 G; 81 T; 2 other; ggagtgaaac aacttgtcgt cggtgtcaac aaaatggact ccaccgaacc accttacagt 60 gaaaaccgtt tcgatgaaat caaaaaagaa gtctcttcat atatcaagaa gattggttac 120 aacccagccg ctgttgcstt cgtacctatt tctggttggc atggggacaa catgttagaa 180 tcttctgcga agatgccatg gttcaaagga tggaatgttg accgtaaaga aggtaaagct 240 gaaggcaaga ccctcattga tgctttggat gccatcytac ccccatctcg tcccacagac 300 aaacctcttc gtcttcccct tca 323 // ID LN889147; SV 1; linear; genomic DNA; STD; INV; 281 BP. XX AC LN889147; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nedyus quadrimaculatus partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3910 XX KW . XX OS Nedyus quadrimaculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Ceutorhynchinae; Nedyus. XX RN [1] RP 1-281 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; aade9aa66132d0782da61bc81403305f. XX FH Key Location/Qualifiers FH FT source 1..281 FT /organism="Nedyus quadrimaculatus" FT /isolate="ARC3910" FT /mol_type="genomic DNA" FT /db_xref="taxon:202049" FT CDS <1..>281 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0Z1" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0Z1" FT /protein_id="CUR49978.1" FT /translation="TEPPYRESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGXNML FT EPSSKMPWFKGWAVDRKEGKAEGKCLIEALDAILPPSRPTDKALRLPL" XX SQ Sequence 281 BP; 77 A; 75 C; 59 G; 69 T; 1 other; actgaaccac cctacaggga atcccgtttt gaagaaatca aaaaggaagt ttcttcgtac 60 atcaagaaaa ttggctacaa ccctgctgct gttgctttcg tacccatctc tggatggcac 120 ggakacaaca tgttggaacc ttccagcaaa atgccctggt tcaagggatg ggctgtcgac 180 cgtaaagaag gcaaagctga aggaaaatgc ctcatcgaag ctctggatgc tatccttcct 240 ccatctcgtc ctactgacaa ggctcttcgt cttccacttc a 281 // ID LN889148; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889148; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinusa tetra partial Elongation factor 1-alpha gene for Elongation factor DE 1-alpha, isolate ARC3917 XX KW . XX OS Rhinusa tetra OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Mecinini; Rhinusa. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f202e903a6e241466b0dd78e7404dbd9. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Rhinusa tetra" FT /isolate="ARC3917" FT /mol_type="genomic DNA" FT /db_xref="taxon:526605" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3D3" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3D3" FT /protein_id="CUR49979.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLESSTKMPWFKGWNIERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 99 A; 79 C; 67 G; 78 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc accttacagc 60 gaaagccgtt ttgaagaaat caagaaggaa gtatcttctt acatcaagaa aattggttac 120 aatccagctg ctgttgcctt tgtacccatc tcaggatggc acggagacaa catgttggaa 180 tcctccacca aaatgccatg gttcaaggga tggaacattg aacgtaagga aggcaaggct 240 gaaggaaaga ctcttatcga tgctttggat gccatccttc ccccaagtcg tcctactgac 300 aaacctcttc gtcttcctct aca 323 // ID LN889149; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889149; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Larinus turbinatus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3919 XX KW . XX OS Larinus turbinatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cleoninae; Larinus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f8e34aeca55bf287ffa9bf7766173c26. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Larinus turbinatus" FT /isolate="ARC3919" FT /mol_type="genomic DNA" FT /db_xref="taxon:202011" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY87" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY87" FT /protein_id="CUR49980.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWNIERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 100 A; 75 C; 65 G; 82 T; 1 other; ggagtaaaac aacttatygt cggtgttaac aaaatggact ccactgaacc accatacagt 60 gaatctcgtt ttgaagaaat caagaaagaa gtctcgtcat acatcaaaaa gattggttac 120 aatcctgctg ctgttgcctt tgtacccatt tctggttggc atggagacaa catgttggaa 180 ccatccacca aaatgccatg gttcaaggga tggaacatcg aacgtaaaga aggaaaagct 240 gaaggaaaga cccttattga tgctttggat gccatccttc ctcctagtcg tcctacagac 300 aagccactcc gtcttcctct tca 323 // ID LN889150; SV 1; linear; genomic DNA; STD; INV; 245 BP. XX AC LN889150; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cionus thapsus partial Elongation factor 1-alpha gene for Elongation factor DE 1-alpha, isolate ARC3920 XX KW . XX OS Cionus thapsus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cioninae; Cionus. XX RN [1] RP 1-245 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d614a008e415bd1bda75c5dcc4aaadd8. XX FH Key Location/Qualifiers FH FT source 1..245 FT /organism="Cionus thapsus" FT /isolate="ARC3920" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738164" FT CDS <1..>245 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0Z2" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0Z2" FT /protein_id="CUR49981.1" FT /translation="IKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASXKMPWFKGW FT AVERKEGKADGKTLIEALDSILPPSRPTDKPLRLPL" XX SQ Sequence 245 BP; 65 A; 65 C; 50 G; 64 T; 1 other; atcaaaaagg aagtatcctc atacatcaaa aagatcggtt acaaccctgc cgctgttgct 60 ttcgtaccta tctctggttg gcacggagac aacatgttgg aagcttccrc caagatgcca 120 tggttcaagg gatgggctgt tgaacgtaaa gaaggcaaag ctgatggcaa gaccctcatt 180 gaagctttgg actctattct tccaccatct cgtcctactg acaaacctct tcgtcttccc 240 cttca 245 // ID LN889151; SV 1; linear; genomic DNA; STD; INV; 239 BP. XX AC LN889151; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinoncus castor partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3921 XX KW . XX OS Rhinoncus castor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Ceutorhynchinae; Rhinoncus. XX RN [1] RP 1-239 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4d3b8977fa9b5967d5f28ab2c5df62c5. XX FH Key Location/Qualifiers FH FT source 1..239 FT /organism="Rhinoncus castor" FT /isolate="ARC3921" FT /mol_type="genomic DNA" FT /db_xref="taxon:878412" FT CDS <1..>239 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L162" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L162" FT /protein_id="CUR49982.1" FT /translation="KEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWNV FT ERKEGKAEGKTLIEALDAILPPSRPTDKPLRLPL" XX SQ Sequence 239 BP; 65 A; 58 C; 48 G; 68 T; 0 other; aaggaagttt cttcttacat caaaaaaatt ggttacaatc ctgctgctgt tgctttcgtt 60 ccaatctctg gatggcatgg agacaacatg ttagaacctt ccactaaaat gccttggttc 120 aagggatgga atgttgaacg taaagaaggc aaagctgaag gaaagactct aattgaggct 180 ttggatgcca tcctgcctcc ctctcgtcct actgacaaac ctctccgtct tccccttca 239 // ID LN889152; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889152; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dorytomus longimanus partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3924 XX KW . XX OS Dorytomus longimanus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Brachyceridae; OC Erirhininae; Dorytomus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 23713af31712806fa85236d5e0cd21b7. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Dorytomus longimanus" FT /isolate="ARC3924" FT /mol_type="genomic DNA" FT /db_xref="taxon:201904" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KZJ4" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZJ4" FT /protein_id="CUR49983.1" FT /translation="GVKQLIVGVNKMDSTEPAYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLESSAKMPWFKGWAVERKEGKADGKTLIEALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 90 A; 86 C; 69 G; 78 T; 0 other; ggagtaaaac aacttatcgt cggcgtcaac aaaatggact ccactgaacc agcttacagc 60 gaaagccgtt tcgaagaaat caaaaaggaa gtctcttcat acatcaagaa gatcggttac 120 aacccagctg ctgttgcctt cgtacccatc tctggttggc atggagacaa catgttggaa 180 tcctccgcca agatgccctg gttcaaggga tgggccgttg aacgtaaaga aggtaaagct 240 gatggaaaga cccttattga agctttggat gccatccttc ctccctctcg tcctactgac 300 aaacctcttc gtcttcccct tca 323 // ID LN889153; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889153; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Bothynoderes sp. ARC3928 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3928 XX KW . XX OS Bothynoderes sp. ARC3928 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Lixinae; Bothynoderes; unclassified Bothynoderes. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9740b3e299db6b3f9afca239cb198382. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Bothynoderes sp. ARC3928" FT /isolate="ARC3928" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736920" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0Y6" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0Y6" FT /protein_id="CUR49984.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHXDNXLEPSTKMPWFKGWNIERKEGKADGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 98 A; 76 C; 63 G; 84 T; 2 other; ggagtaaaac aacttatcgt cggtgttaac aaaatggact ccactgaacc accatacagt 60 gaatctcgtt ttgaagaaat caagaaggaa gtctcttcat acatcaagaa aattggttac 120 aacccggccg ctgttgcttt tgtgcccatt tctggttggc atgkagacaa cawgttggaa 180 ccatccacca aaatgccatg gttcaaagga tggaacattg aacgtaaaga aggaaaagct 240 gatggaaaga cccttattga tgctttggat gccatccttc ctccttctcg tcctacagac 300 aaaccacttc gtcttcctct tca 323 // ID LN889154; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889154; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cleogonus rubetra partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3950 XX KW . XX OS Cleogonus rubetra OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Cleogonini; Cleogonus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8cd565e363a1994de9f6a6842c9734ba. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Cleogonus rubetra" FT /isolate="ARC3950" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738165" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KY55" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY55" FT /protein_id="CUR49985.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWNIERKEGKAEGKTLIDALDAILPPSRPTEKPLR FT LPL" XX SQ Sequence 323 BP; 100 A; 81 C; 65 G; 77 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc accatacagt 60 gaatctcgtt ttgaagaaat caagaaggaa gtatcttcat acatcaagaa aatcggttac 120 aacccagccg ctgttgcctt tgtacccatc tctggatggc acggagacaa tatgttggaa 180 ccttccacca aaatgccatg gttcaaggga tggaacatcg aacgtaaaga aggcaaagct 240 gaaggaaaga ctctcattga tgctttggat gccatccttc caccctctcg tccaactgaa 300 aagcctcttc gtcttcctct gca 323 // ID LN889155; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889155; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Phalias sp. ARC3953 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3953 XX KW . XX OS Phalias sp. ARC3953 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Phalias; unclassified Phalias. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2ad1ab5f83d2529b2df6e95b94dd1e66. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Phalias sp. ARC3953" FT /isolate="ARC3953" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736990" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L5G5" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5G5" FT /protein_id="CUR49986.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWAVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 99 A; 75 C; 71 G; 77 T; 1 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc accatacagt 60 gaaccgagat tcgaagaaat caagaaggaa gtatcttcct atataaagaa gattggttac 120 aatccagctg cggtagcttt tgtaccaatc tctggttggc atggagacaa tatgttagaa 180 gcttccacca agatgccttg gttcaaagga tgggctgttg aacgcaagga gggcaaagcg 240 gaaggaaaaa cccttattga tgccttggat gccattcttc cccctagtcg cccaacagac 300 aaacctcttc gycttcctct tca 323 // ID LN889156; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889156; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulus sp. ARC3955 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3955 XX KW . XX OS Eubulus sp. ARC3955 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulus; unclassified Eubulus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2444fc8cb04b96319f6218d678441a94. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Eubulus sp. ARC3955" FT /isolate="ARC3955" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736926" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYE9" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYE9" FT /protein_id="CUR49987.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 99 A; 74 C; 65 G; 85 T; 0 other; ggagtaaaac aacttatcgt tggtgtcaac aaaatggatt ccactgaacc accatacagc 60 gaagctcgtt ttgaagaaat taaaaaagaa gtgtcttcat acattaagaa aattggttac 120 aatccagctg ctgtcgcttt cgtacccatc tctggttggc atggagacaa tatgttggag 180 ccttccacca aaatgccctg gttcaaggga tggaatgtag agcgtaaaga aggtaaagcc 240 gaaggaaaaa cccttattga tgctttagat gccatcctgc caccttctcg tcctacagac 300 aaacctcttc gtcttcctct tca 323 // ID LN889157; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889157; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Metoposoma cf. funebris MB-2015 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3956 XX KW . XX OS Metoposoma cf. funebris MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Metoposoma. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e8c0455b4501e5a254b5bf66937d7181. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Metoposoma cf. funebris MB-2015" FT /isolate="ARC3956" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738352" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3N9" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3N9" FT /protein_id="CUR49988.1" FT /translation="GVKQLIVGVNKMDLTEPAYSEPRFEEIKKEVSSYIKKIGYNPAAV FT AFVPICGWHGDNMLEASSKMPWFKGWAIERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 98 A; 69 C; 67 G; 89 T; 0 other; ggagtaaaac aacttatcgt tggtgttaat aaaatggact tgactgaacc agcatacagt 60 gaacctcgtt tcgaagaaat taaaaaagaa gtatcttcat acatcaaaaa aattggttac 120 aatcctgctg ctgttgcctt tgtacctatc tgtggctggc atggagacaa catgttggaa 180 gcttccagca agatgccatg gttcaaggga tgggctattg aacgtaaaga aggaaaagct 240 gaaggaaaga ctctcatcga tgctttggat gccattctcc caccttctcg tcctactgac 300 aaacctcttc gtcttcctct tca 323 // ID LN889158; SV 1; linear; genomic DNA; STD; INV; 296 BP. XX AC LN889158; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulus sp. ARC3957 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3957 XX KW . XX OS Eubulus sp. ARC3957 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulus; unclassified Eubulus. XX RN [1] RP 1-296 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e14ee1fe77bafec5543ae15f86851c25. XX FH Key Location/Qualifiers FH FT source 1..296 FT /organism="Eubulus sp. ARC3957" FT /isolate="ARC3957" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736927" FT CDS <1..>296 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KZ08" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ08" FT /protein_id="CUR49989.1" FT /translation="NKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWH FT GDNMLEPSTKMPWFKGWNVDRKEGKAEGKTLIDALDAILPPSRPTDKPLRLPL" XX SQ Sequence 296 BP; 91 A; 72 C; 60 G; 73 T; 0 other; aacaaaatgg attcaaccga gccaccatac agtgaacctc gttttgaaga aatcaagaaa 60 gaagtatctt catacattaa gaaaattggt tataacccgg ctgctgttgc tttcgtacct 120 atttctggtt ggcatgggga caacatgttg gaaccttcca ccaaaatgcc atggttcaag 180 ggatggaacg ttgatcgtaa agaaggcaag gctgaaggaa aaaccctcat tgatgctttg 240 gatgccatcc taccacccag tcgccctaca gacaaaccac ttcgtcttcc ccttca 296 // ID LN889159; SV 1; linear; genomic DNA; STD; INV; 296 BP. XX AC LN889159; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3958 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3958 XX KW . XX OS Cryptorhynchini gen. sp. ARC3958 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-296 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8bb34037136946a98310d2ca1963a975. XX FH Key Location/Qualifiers FH FT source 1..296 FT /organism="Cryptorhynchini gen. sp. ARC3958" FT /isolate="ARC3958" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742681" FT CDS <1..>296 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L355" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L355" FT /protein_id="CUR49990.1" FT /translation="NKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWH FT GDNMLEPSNKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLRLPL" XX SQ Sequence 296 BP; 90 A; 69 C; 60 G; 77 T; 0 other; aacaaaatgg actccactga accaccatac agtgaatctc gttttgaaga aatcaaaaaa 60 gaagtgtctt catacatcaa gaaaattggt tataacccag ctgctgttgc tttcgtgcct 120 atttctggtt ggcatggaga caacatgttg gaaccatcta acaagatgcc ctggttcaag 180 ggatggaatg ttgagcgtaa agaaggtaaa gctgaaggaa agacccttat tgatgcgcta 240 gatgccatcc tgccaccctc tcgtccaact gacaaacctc ttcgtcttcc tcttca 296 // ID LN889160; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889160; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cophes sp. ARC3962 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3962 XX KW . XX OS Cophes sp. ARC3962 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cophes; unclassified Cophes. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6d8b887c2329011ee2d6c45104e4cf3b. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Cophes sp. ARC3962" FT /isolate="ARC3962" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736960" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4KYI7" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYI7" FT /protein_id="CUR49991.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEPSTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 94 A; 83 C; 68 G; 78 T; 0 other; ggagtaaaac aacttatcgt cggtgtcaac aaaatggact ccactgaacc accatacagc 60 gaatctcgtt ttgaagaaat taagaaagaa gtgtcttcat acatcaagaa gattggttac 120 aacccggctg ctgttgcctt cgtacccatc tctggctggc acggggacaa catgttggag 180 ccatctacca aaatgccatg gttcaaggga tggaatgttg aacgcaaaga aggcaaagct 240 gaaggaaaga ccctcattga tgctttggat gccatccttc caccctctcg tcctaccgac 300 aaacctcttc gtcttcctct tca 323 // ID LN889161; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889161; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhyssomatus sp. ARC3965 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3965 XX KW . XX OS Rhyssomatus sp. ARC3965 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Cleogonini; Rhyssomatus; unclassified Rhyssomatus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 452aa3d3d556753a12941cb043469389. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Rhyssomatus sp. ARC3965" FT /isolate="ARC3965" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736948" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L1F1" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1F1" FT /protein_id="CUR49992.1" FT /translation="GVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 98 A; 76 C; 73 G; 76 T; 0 other; ggagtaaagc aattgattgt cggtgtaaat aaaatggact ccactgaacc accatacagc 60 gaaagtcgtt ttgaagaaat caagaaggaa gtctcttcat acatcaagaa gatcggttac 120 aatccagctg ctgtcgcttt cgtaccaatt tcaggatggc acggagacaa catgttggag 180 gcttccacca aaatgccatg gttcaaggga tggaatgttg aacgtaaaga aggcaaggct 240 gaaggaaaga ccctcattga tgctttggat gccattcttc cccccagtcg cccaaccgac 300 aaacctcttc gtcttcctct gca 323 // ID LN889162; SV 1; linear; genomic DNA; STD; INV; 317 BP. XX AC LN889162; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Phyrdenus sp. ARC3968 partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ARC3968 XX KW . XX OS Phyrdenus sp. ARC3968 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Phyrdenus; unclassified Phyrdenus. XX RN [1] RP 1-317 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 062ff69c1ddf865191c28ec881b088bc. XX FH Key Location/Qualifiers FH FT source 1..317 FT /organism="Phyrdenus sp. ARC3968" FT /isolate="ARC3968" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736992" FT CDS <1..>317 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L0W6" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0W6" FT /protein_id="CUR49993.1" FT /translation="KQLIVGVNKMDSTEPAYSESRFEEIKKEVSSYIKKIGYNPAAVAF FT VPISGWHGDNMLEASTKMPWFKGWNIERKEGKAEGKTLIDALDAILPPARPTDKPLRLP FT L" XX SQ Sequence 317 BP; 102 A; 76 C; 61 G; 78 T; 0 other; aaacaactta tcgtcggtgt caacaaaatg gactccactg aaccagctta cagtgaatca 60 cgatttgaag aaatcaaaaa agaagtatct tcatatatca agaagattgg ttacaaccca 120 gctgcagttg cctttgtacc catctctgga tggcatggag acaacatgtt ggaagcctct 180 accaaaatgc catggttcaa aggatggaac attgaacgta aagaaggaaa agctgaagga 240 aagaccctca ttgatgcttt ggatgctatc cttccacctg ctcgtcccac tgacaaaccc 300 cttcgtcttc ctcttca 317 // ID LN889163; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889163; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Zascelis cf. irrorata MB-2015 partial Elongation factor 1-alpha gene for DE Elongation factor 1-alpha, isolate ARC3980 XX KW . XX OS Zascelis cf. irrorata MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Zascelis. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 36e068b384d7e870ff293dacd36ff572. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Zascelis cf. irrorata MB-2015" FT /isolate="ARC3980" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738371" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L105" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L105" FT /protein_id="CUR49994.1" FT /translation="GVKQLIVGVNKMDSTEPPYSEGRFEEIKKEVSSYIKKIGYNPAAV FT AFVPISGWHGDNMLEXSTKMPWFKGWNVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 92 A; 67 C; 69 G; 94 T; 1 other; ggagtaaaac aacttatcgt tggtgttaat aaaatggatt ctactgaacc accatacagt 60 gaaggtcgtt tcgaggaaat taaaaaagaa gtatcatctt acattaagaa gattggttac 120 aaccctgctg ctgttgcttt tgtgcctatc tctggttggc atggagacaa catgttggaa 180 tyttcgacca agatgccttg gttcaaggga tggaatgttg accgtaaaga aggcaaagct 240 gaaggaaaaa ccctcattga tgctttggat gctatcctgc ctccttctcg tcctactgac 300 aaacctcttc gtcttcccct tca 323 // ID LN889164; SV 1; linear; genomic DNA; STD; INV; 323 BP. XX AC LN889164; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Torneuma deplanatum partial Elongation factor 1-alpha gene for Elongation DE factor 1-alpha, isolate ZFMK-DNA-0100400462 XX KW . XX OS Torneuma deplanatum OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Torneuma; Typhloporus. XX RN [1] RP 1-323 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0059b87ffc5aff09b0655ec7042ac9f5. XX FH Key Location/Qualifiers FH FT source 1..323 FT /organism="Torneuma deplanatum" FT /isolate="ZFMK-DNA-0100400462" FT /mol_type="genomic DNA" FT /db_xref="taxon:501687" FT CDS <1..>323 FT /codon_start=1 FT /transl_table=1 FT /gene="Elongation factor 1-alpha" FT /product="Elongation factor 1-alpha" FT /db_xref="GOA:A0A0S4L3F0" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3F0" FT /protein_id="CUR49995.1" FT /translation="GVRQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAV FT VFVPISGWHGDNMLEPSSKMPWFKGWSVDRKEGKAEGKTLIDALDAILPPSRPTDKPLR FT LPL" XX SQ Sequence 323 BP; 91 A; 77 C; 74 G; 81 T; 0 other; ggagtacgac aacttatcgt gggtgtgaac aagatggact ccactgaacc accatacagc 60 gaaagtcgtt ttgaagaaat caagaaggaa gtctcttcat acatcaagaa gattggttac 120 aatccagctg ctgtggtctt tgttcccatt tctggttggc atggggacaa catgttggaa 180 ccttccagca agatgccatg gttcaaggga tggagtgttg accgtaaaga aggcaaagct 240 gaaggaaaaa ctcttatcga tgctctggat gctatcctcc caccctctcg tccaactgac 300 aaacctcttc gtcttcccct aca 323 // ID LN889165; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889165; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0601 partial Enolase gene for Enolase, isolate DE ARC0601 XX KW . XX OS Cryptorhynchini gen. sp. ARC0601 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4e05832c2b8fce166592315946aa6475. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Cryptorhynchini gen. sp. ARC0601" FT /isolate="ARC0601" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742674" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYA4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYA4" FT /protein_id="CUR49996.1" FT /translation="AAVPSGASTGIHEALELRDEIKEDYMGKGVNKAVDNVNKGIGPEL FT VKQNFDVTQQEEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIS" XX SQ Sequence 600 BP; 201 A; 134 C; 136 G; 129 T; 0 other; gctgccgttc cgtcaggtgc cagtacaggt atccacgagg cgttagaact cagagatgaa 60 attaaagaag attatatggg taaaggagtg aataaagcag tagacaacgt gaataaaggt 120 atcggtcccg agctagtaaa acagaatttc gatgttaccc aacaggaaga aatcgacgag 180 tttatgatca aactagacgg caccgaaaat aaatcgaaat ttggagccaa tgccatatta 240 ggagtttctc ttgctgtatg caaggccggt gccgccaagc gaggagtgcc actctatcga 300 catatagccg atttagcagg aaataaaaac attatccttc ccgtcccagc tttcaacgta 360 atcaacggag gttcacatgc aggaaacaaa ctggcgatgc aagaattcat gatccttcca 420 actggggctt gttcctttac ggaagccatg aaaatgggca gcgaaactta ccataacctg 480 aaaaagatta tcaaagacaa gtacggtctt gacgccaccg cagtaggaga cgaaggcggc 540 ttcgcgccta acatcacaaa taacaaagat gcccttcaaa tcatcaatga tgccatctcc 600 // ID LN889166; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889166; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pseudoporopterus sp. ARC0884 partial Enolase gene for Enolase, isolate DE ARC0884 XX KW . XX OS Pseudoporopterus sp. ARC0884 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pseudoporopterus; unclassified Pseudoporopterus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0981ffcd4cc437e7288a378623024816. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Pseudoporopterus sp. ARC0884" FT /isolate="ARC0884" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737006" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L103" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L103" FT /protein_id="CUR49997.1" FT /translation="AAVPSGASTGIHEALELRDEIPEEYVGKGVGKAVGNVNNSIGPEL FT VKQSFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMLLPTGACSFTEAMKMGSETYHALKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 177 A; 133 C; 153 G; 137 T; 0 other; gccgccgtac cgtcaggtgc tagcacaggt attcacgagg ccttagagct cagagacgaa 60 atccccgaag aatatgtggg caaaggagtc ggcaaggcgg tgggtaatgt gaataattcc 120 attggtccgg aactagtgaa acagagtttc gatgttaccc agcaggaaga gatcgacgat 180 tttatgataa aacttgacgg taccgagaat aaatcgaaat ttggtgccaa tgccatttta 240 ggggtatctt tagctgtatg caaagccggt gctgccaaac ggggagttcc cttgtatcga 300 cacatagctg atttagccgg aaacaaaaac attatcctcc cggtgcccgc ctttaacgtg 360 attaatggag gttcacatgc aggaaacaag ctggctatgc aagaatttat gcttcttccg 420 actggagcgt gctcttttac cgaagctatg aaaatgggca gcgaaaccta ccacgcccta 480 aagaaaatta tcaaagataa atatggcttg gacgccactg cagtgggaga tgaaggtggg 540 ttcgctccga acatcaccaa caacaaagac gcgcttctga tcattaacga tgcgatcgcc 600 // ID LN889167; SV 1; linear; genomic DNA; STD; INV; 502 BP. XX AC LN889167; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0886 partial Enolase gene for Enolase, isolate DE ARC0886 XX KW . XX OS Cryptorhynchini gen. sp. ARC0886 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-502 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a7f1f27a446fbdc85aba291d004672ba. XX FH Key Location/Qualifiers FH FT source 1..502 FT /organism="Cryptorhynchini gen. sp. ARC0886" FT /isolate="ARC0886" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742675" FT CDS <1..>502 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L173" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L173" FT /protein_id="CUR49998.1" FT /translation="LRDDIPEQYMGKGVGKAVEHVIKDIGPPLVSQHFDITQQEEIDEF FT MIKLDGTDNKANFGANAILGVSLAVCKAGAAKRGVPLYRHIXDLAGNKHLILPVPAFNV FT INGGSHAGNKLAMQEFMILPTGACSFTEAMKMGXETYHHLKKIIKDKYGLDATAVGDEG FT GFAP" XX SQ Sequence 502 BP; 146 A; 109 C; 123 G; 117 T; 7 other; ctcagagatg atattccgga gcagtacatg ggaaaaggtg taggcaaagc agtcgaacat 60 gtgatcaaag acattggtcc tccgttggtg agtcaacact ttgacatcac ccagcaagaa 120 gaaattgatg agtttatgat taaactggat ggtactgaca ataaagccaa ttttggtgcc 180 aacgccattt tgggagtgtc cttagcrgtc tgcaaagctg gwgcmgccaa acgtggrgtt 240 ccactctatc ggcatatarc agacttggca ggaaacaagc acctcattct acctgttcct 300 gcttttaacg tcattaacgg aggttcgcac gcaggaaaca aactggctat gcaagaattc 360 atgatccttc ctactggagc ctgttccttt acggargcga tgaaaatggg cascgagact 420 taccatcatt tgaagaagat catcaaagat aaatacggac tggacgccac tgcagtggga 480 gacgaaggtg ggttcgcacc ca 502 // ID LN889168; SV 1; linear; genomic DNA; STD; INV; 572 BP. XX AC LN889168; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles sp. ARC0888 partial Enolase gene for Enolase, isolate ARC0888 XX KW . XX OS Acalles sp. ARC0888 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles; unclassified Acalles. XX RN [1] RP 1-572 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bc2973c55245afa97c93ab1e446be51a. XX FH Key Location/Qualifiers FH FT source 1..572 FT /organism="Acalles sp. ARC0888" FT /isolate="ARC0888" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736914" FT CDS <1..>572 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZK9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZK9" FT /protein_id="CUR49999.1" FT /translation="AAVPSGASTGIHEALELRDNIPQDYMGKGVCKAVEHVNQCIGPEL FT VKQNFDVTQQEEIDEFMIKLDGTDNKAKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDA" XX SQ Sequence 572 BP; 160 A; 139 C; 156 G; 114 T; 3 other; gctgctgtcc cctcaggggc cagtacaggt atccatgaag ctttggagct cagagacaat 60 atcccccagg actacatggg caaaggtgtt tgcaaagcgg tggagcacgt gaatcaatgc 120 attgggccag agttggtaaa gcaaaacttc gatgtcaccc aacaggagga aatcgatgag 180 ttcatgatta agttggacgg taccgataat aaggcgaagt ttggcgccaa tgccattcta 240 ggcgtgtcat tggccgtctg caaagccggt gctgctaaac gaggagttcc actgtatcga 300 catattgcag acttagcagg gaataaaaat ctcattcttc cagtaccggc ttttaacgtc 360 atcaacgggg gttctcacgc aggaaacaag ctggccatgc aggagttyat gattctkccc 420 actggggcgt gcagtttcac cgargcgatg aagatgggca gcgagaccta ccacaacctg 480 aagaaaatca ttaaggacaa atacgggctg gacgccaccg cggtgggaga cgagggcggc 540 ttcgccccca acatcaccaa caacaaagac gc 572 // ID LN889169; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889169; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nechyrus cf. porcatus MB-2015 partial Enolase gene for Enolase, isolate DE ARC0893 XX KW . XX OS Nechyrus cf. porcatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nechyrus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 72b1ac706af8ed5cb905fe919023f6b2. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Nechyrus cf. porcatus MB-2015" FT /isolate="ARC0893" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738357" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L106" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L106" FT /protein_id="CUR50000.1" FT /translation="AAVPSGASTGIHEALELRDDIPEHYLGKGVSKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAICKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 190 A; 126 C; 137 G; 145 T; 2 other; gctgcggttc catcaggtgc cagtacaggt atccacgaag cgttagaact cagagacgat 60 attccagaac attatctcgg caaaggagtc agtaaagcgg tagacaatgt gaataaatcc 120 attggcccgg agctcgtaaa acagaatttc gatgtcaccc aacaggagga aatcgatgat 180 tttatgatta agctagatgg cactgagaat aaatcgaatt ttggygctaa tgccatttta 240 ggagtctcac ttgctatatg taaagctggt gctgccaaac gcggagtgcc gctataccga 300 catatagctg atttagccgg aaataaaaat attatcctcc ccgttccggc tttcaacgtc 360 attaatggag gttctcatgc cggaaacaag ctggcgatgc aagaattcat gattctycca 420 actggagcat gctcttttac ggaagccatg aagatgggaa gcgaaactta ccacaacttg 480 aagaaaatta tcaaagacaa gtatggtctt gacgctactg cagtaggaga tgaaggtggg 540 ttcgcaccaa acatcacaaa taacaaagat gcccttctaa tcatcaatga tgccattgcg 600 // ID LN889170; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889170; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantiala illusa partial Enolase gene for Enolase, isolate ARC0900 XX KW . XX OS Pantiala illusa OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pantiala. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1027ec8916e775f6c694e1f98b6d08c3. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Pantiala illusa" FT /isolate="ARC0900" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738267" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KY73" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY73" FT /protein_id="CUR50001.1" FT /translation="AAVPSGASTGIHEALELRDENPHDYMGKGVSKAVENVNKSIGPEL FT VKQNFDVTQQEEIDEFMINLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMLLPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIS" XX SQ Sequence 600 BP; 182 A; 144 C; 148 G; 126 T; 0 other; gcagcggtac cctcaggtgc cagtacggga attcacgaag ctttggaact ccgagatgag 60 aatccgcatg attatatggg aaaaggcgtg tctaaagccg tagagaatgt gaacaaatcg 120 attggacccg agttggtgaa acagaatttc gatgttaccc aacaagagga aatcgacgaa 180 tttatgatta acttggacgg caccgagaat aagtcaaaat tcggagctaa cgccattttg 240 ggcgtttcct tggctgtgtg caaagccggg gctgctaaac ggggcgtgcc cttataccga 300 catatagctg atttagcggg aaacaaaaat ataatcctcc ccgtgccggc tttcaacgtc 360 atcaacggag gctcacacgc aggcaacaaa ctagcgatgc aagaattcat gcttcttccc 420 actggcgcat gctccttcac cgaagccatg aagatgggtt ccgaaaccta ccacaacttg 480 aagaaaatca tcaaagacaa gtacggtctg gacgcaaccg cagtgggaga cgaaggtggt 540 ttcgcaccga acatcacaaa caacaaggac gctctactga tcattaacga tgccatttcg 600 // ID LN889171; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889171; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Doetes sp. ARC0906 partial Enolase gene for Enolase, isolate ARC0906 XX KW . XX OS Doetes sp. ARC0906 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Doetes; unclassified Doetes. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f3cac7b26fb36f0288db33cc245e5efe. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Doetes sp. ARC0906" FT /isolate="ARC0906" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736964" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L5H9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5H9" FT /protein_id="CUR50002.1" FT /translation="AAVPSGASTGIHEALELRDDVPQDYLGKGVSKAVDHVNTSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKHLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 185 A; 129 C; 142 G; 143 T; 1 other; gctgctgtac cgtccggtgc tagtacaggt attcacgaag ctttggaact cagagacgac 60 gttccgcaag actacctagg caaaggagtc agtaaagcgg tcgaccatgt saatacgtcc 120 ataggacctg aattggtgaa gcaaaacttc gatgtcaccc aacaagagga gatcgacgat 180 tttatgatta aattagacgg tacggagaat aaatcgaaat tcggggccaa tgccattcta 240 ggtgtatcgc ttgcagtatg caaggctggt gctgctaaac gaggagtacc tttatatcga 300 cacatagctg acttggctgg aaataaacac ctaatccttc ctgtcccagc tttcaacgtt 360 attaatggcg gttcacatgc tggaaacaag ctggcgatgc aagagttcat gattcttcca 420 actggagcgt gctcttttac ggaagctatg aagatgggca gcgaaactta tcataacttg 480 aagaaaatta ttaaagacaa atatggcttg gacgccaccg cagtaggaga tgaaggcgga 540 tttgcaccca acattaccaa taacaaagac gcccttcaaa taatcaatga tgcgattgcc 600 // ID LN889172; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889172; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mechistocerus violatus partial Enolase gene for Enolase, isolate ARC0908 XX KW . XX OS Mechistocerus violatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Mechistocerus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; db17bba1344c4b0a89d4677438d4ebcf. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Mechistocerus violatus" FT /isolate="ARC0908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742697" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYF9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYF9" FT /protein_id="CUR50003.1" FT /translation="AAVPSGASTGVHEALELRDNVPEDYVGKGVSKAVENVNSSIGPEL FT TKQDFDVTQQEEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 196 A; 117 C; 135 G; 152 T; 0 other; gccgcagttc catcaggtgc tagtacaggt gttcatgaag ctttggagct cagagacaat 60 gttcctgaag attacgtagg aaaaggtgtc agtaaagcag tagaaaacgt aaacagttcc 120 attggacccg agctgacgaa acaagatttt gatgttaccc aacaagaaga aatcgacgaa 180 tttatgataa aacttgacgg aactgaaaac aaatcaaaat ttggagcaaa cgcaatttta 240 ggagtgtctc ttgctgtgtg caaagctggt gccgcaaaac gaggcgtccc cctttataga 300 catatcgctg atttggctgg aaataagaat cttatcctac ccgttcccgc ttttaatgta 360 attaatggag gttctcacgc tggaaataag ctggctatgc aagaattcat gattctccca 420 actggcgcgt gctcttttac tgaagcgatg aagatgggca gtgaaactta tcacaacctg 480 aaaaaaatta ttaaggacaa atacggactt gatgcaaccg cagtgggaga tgaaggtggg 540 tttgccccaa atattaccaa taataaagat gctcttcaaa tcataaatga tgccatcgct 600 // ID LN889173; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889173; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0909 partial Enolase gene for Enolase, isolate DE ARC0909 XX KW . XX OS Cryptorhynchini gen. sp. ARC0909 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d60ebef639253808155ebdf0e2b094a7. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Cryptorhynchini gen. sp. ARC0909" FT /isolate="ARC0909" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742676" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3Q5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3Q5" FT /protein_id="CUR50004.1" FT /translation="AAVPSGASTGIHEALELRDEIPEEYVGKGVSKAVCNVNNSIGPEV FT VKQNFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAICKAGAAKRGVPLYRHIAD FT LCGNKNIILPVPAFNVINGGSHAGNKLAMQEFMLLPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 181 A; 141 C; 145 G; 132 T; 1 other; gctgccgtac cgtcaggtgc tagcacaggt atccacgaag cyttagaact cagagacgaa 60 attcccgaag aatatgtggg caaaggggtc agtaaggcgg tctgtaacgt gaataattcc 120 atcggtccgg aagttgtgaa acagaatttc gatgtcaccc agcaggaaga gatcgacgat 180 tttatgataa aacttgacgg taccgagaat aaatcgaaat ttggcgccaa tgccatttta 240 ggcgtatcac tggctatatg caaagccggt gctgccaagc ggggagtccc tttgtatcga 300 cacatagctg atttatgcgg aaacaaaaac attatcctcc cagtgcccgc cttcaacgtt 360 attaacggag gttcacacgc aggaaacaag ctggcgatgc aagaatttat gcttcttccg 420 actggagctt gctcttttac cgaagccatg aaaatgggca gcgaaactta ccacaaccta 480 aagaaaatta tcaaagataa atacggtttg gacgccactg cagtggggga tgaaggcggg 540 ttcgccccga acattaccaa caacaaagac gcccttctga tcatcaacga tgccatcgcc 600 // ID LN889174; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889174; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Critomerus iliacus partial Enolase gene for Enolase, isolate ARC0914 XX KW . XX OS Critomerus iliacus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Critomerus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f526104cb76c3c72f751255a2442a3a5. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Critomerus iliacus" FT /isolate="ARC0914" FT /mol_type="genomic DNA" FT /db_xref="taxon:1471361" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZ21" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ21" FT /protein_id="CUR50005.1" FT /translation="AAVPSGASTGIHEALELRDENPQEYMGKGVSKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LCGNKNIILPVXAFNVINGGSHAGNKLAMQEFMILPTGACXFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIS" XX SQ Sequence 600 BP; 193 A; 132 C; 132 G; 135 T; 8 other; gccgccgtgc cstcaggtgc tagcacaggt atccacgaag ctttagaact cagagatgag 60 aatccgcaag aatatatggg aaaaggggtg tccaaagccg tagacaatgt aaacaaatcc 120 atcggccccg aattagtcaa acagaacttc gatgtgaccc aacaagaaga aatcgatgat 180 tttatgatta aactagatgg aactgagaat aaatcgaatt tcggagcyaa cgccatttta 240 ggagtttcyc tcgccgtatg taaagccggt gcggctaaac gtggagtacc tttatatcga 300 catatagccg atttatgcgg aaacaaaaat ataattctgc cwgttcmggc tttcaacgtc 360 attaacggag gctcacaygc cggaaataaa ctggcgatgc aagaattcat gattcttcca 420 actggcgcct gctsttttac cgaagccatg aagatgggct ccgaaactta tcacaactta 480 aagaaaatca tcaaagacaa atacggtctc gacgcaaccg ccgtgggaga tgaaggtggr 540 tttgcaccaa acatcacgaa caacaaggat gctcttttga tcatcaatga cgccatttcg 600 // ID LN889175; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889175; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sternochetus mangiferae partial Enolase gene for Enolase, isolate ARC0929 XX KW . XX OS Sternochetus mangiferae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Sternochetus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 129d4dbd223ff7ec971974b688641b81. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Sternochetus mangiferae" FT /isolate="ARC0929" FT /mol_type="genomic DNA" FT /db_xref="taxon:925794" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L372" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L372" FT /protein_id="CUR50006.1" FT /translation="AAVPSGASTGIHEALELRDEIPDQYMGKGVQKAVDNVNNSLGPEL FT VKQNFDVTQQEEIDEFMIKLDGTENKSKFGANAILGISLAVCKAGAAKRGVPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFQEAMKMGSETYHTLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 211 A; 118 C; 129 G; 142 T; 0 other; gcagcagttc cttcaggtgc cagcacagga attcacgaag ctctagaact cagagatgag 60 attccagatc agtatatggg aaaaggcgtc cagaaagcag ttgataacgt aaacaattcg 120 ttaggccctg aattggtaaa acaaaatttt gatgttactc aacaagaaga aatagatgaa 180 tttatgataa aacttgatgg cactgaaaat aagtcaaaat ttggggctaa cgccatttta 240 ggaatatctc ttgcagtatg caaagccggt gctgccaaac gaggagtgcc cttatatcga 300 catatagcag acctagcagg taacaagaat ctcattttac ctgtccccgc tttcaatgta 360 attaatggag gatcacatgc aggaaacaag ctggcaatgc aagaattcat gattctacca 420 actggagcaa attccttcca ggaagctatg aagatgggca gcgaaacgta ccataccctt 480 aaaaaaatca ttaaagacaa atacggatta gatgcaactg cggtgggaga cgaaggtgga 540 tttgcgccca acataactaa caacaaagat gctcttctga ttattaacga tgctatagcc 600 // ID LN889176; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889176; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Xychusa sp. ARC1334 partial Enolase gene for Enolase, isolate ARC1334 XX KW . XX OS Xychusa sp. ARC1334 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Xychusa; unclassified Xychusa. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ac5a14ff7136ef29353fc50ab8991007. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Xychusa sp. ARC1334" FT /isolate="ARC1334" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737028" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYK2" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYK2" FT /protein_id="CUR50007.1" FT /translation="AAVPSGASTGIHEALELRDEDPKDFLGKGVTKAVDNVNKSIGPEL FT VKQNFNITQQEEIDEFLIKLDGTENKGKLGANAILGVSLAVCKAGAARRGVPLYRHIAD FT LARNKHIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFSEAMKMGVETYHTLKKI FT IKDKYGLDATAVGDEGGFAPNIQDNKEALQIINDAIA" XX SQ Sequence 600 BP; 182 A; 133 C; 148 G; 137 T; 0 other; gccgctgttc cctcaggtgc cagtacaggt attcacgaag ccctggaatt gagagacgag 60 gatccgaaag attttctggg caaaggagtg actaaagctg tagataatgt aaacaaatcc 120 atcggccccg aattggtaaa acagaatttc aacattaccc aacaagagga aatcgacgaa 180 tttttgatta aactcgacgg caccgagaat aaaggcaaac taggggcgaa tgccatttta 240 ggagtctcgc ttgctgtttg caaagccgga gcagccagac gaggggtgcc tttgtacaga 300 catatagctg atttagctag gaacaaacat ataattcttc ctgtccccgc ttttaacgtg 360 attaacggag gttcacatgc cggtaataag ctggctatgc aagaattcat gattcttccg 420 acgggggctt gctcgttctc ggaagccatg aagatgggcg tcgaaaccta ccacactcta 480 aagaaaatta ttaaagacaa gtacggtctc gacgctaccg cggtggggga tgaaggcggg 540 ttcgctccca acatacaaga taacaaggag gcccttcaaa tcattaacga tgctattgca 600 // ID LN889177; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889177; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas tricolor partial Enolase gene for Enolase, isolate ARC1339 XX KW . XX OS Arachnobas tricolor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dae7abd35def80eca9ed6988f927a6ff. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Arachnobas tricolor" FT /isolate="ARC1339" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738226" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1G4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1G4" FT /protein_id="CUR50008.1" FT /translation="AAVPSGASTGIHEALELRDEVAQDYMGKGVSKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGCETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 203 A; 110 C; 131 G; 156 T; 0 other; gctgctgtgc cttcaggcgc tagtacaggt attcacgaag ccttagaact cagagatgaa 60 gttgcacaag attatatggg aaaaggggtt agcaaagcgg tagataacgt aaataaatcc 120 atcggtccag agttagtgaa acaaaatttc gatgtcaccc aacaagagga aatcgatgat 180 tttatgatta aattagatgg aaccgaaaat aaatcgaatt ttggtgccaa tgctatttta 240 ggagtatcac tggccgtatg taaagccgga gcagctaaac gaggattacc tttgtataga 300 catatagctg atttagcggg aaataaaaat atcattcttc ctgtcccagc ttttaacgtc 360 attaatggag gttcacatgc tggaaacaaa ttagcaatgc aagaattcat gattcttcca 420 accggagcgt gttcttttac tgaagcaatg aagatgggct gtgaaactta ccataatctc 480 aagaaaatca ttaaagataa atatggcctt gacgccaccg cagtcggaga tgagggtgga 540 ttcgcaccaa acatcacaaa taacaaagat gcgcttttga ttatcaatga tgccatcgcc 600 // ID LN889178; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889178; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe cf. puncticollis MB-2015 partial Enolase gene for Enolase, isolate DE ARC1340 XX KW . XX OS Semiathe cf. puncticollis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dc3ebf498ff87cf5791b74f77f99a3a1. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Semiathe cf. puncticollis MB-2015" FT /isolate="ARC1340" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738368" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L0Y2" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0Y2" FT /protein_id="CUR50009.1" FT /translation="AAVPSGASTGIHEALELRDENPQDFLGKGVFKAVDNVNQYIGPEL FT VKQNFDVTQQEEIDEFMIKLDWTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLXMQEFMLLPTGACSFTEAMKMGAETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNISNNKDALQIINDAIS" XX SQ Sequence 600 BP; 192 A; 117 C; 136 G; 154 T; 1 other; gccgcggttc cttcaggggc tagtacaggt atacacgaag ctctggaact cagagatgag 60 aatccacagg actttctagg caaaggagtg tttaaagctg tggacaatgt gaatcaatat 120 atcggtcccg agttagtaaa acagaatttc gatgtaaccc aacaagagga aatcgatgaa 180 tttatgatta aactcgattg gactgaaaat aaatccaaat ttggggccaa tgcaatttta 240 ggagtttcac tcgctgtatg taaagctggt gctgctaaac gaggggtgcc actgtatcga 300 catatagctg atttagccgg gaataaaaac attattcttc ctgtcccagc ttttaatgtt 360 attaatggag gttctcacgc gggaaataag ttakcgatgc aagagtttat gctccttcca 420 actggagcgt gctcctttac ggaagccatg aaaatgggcg cagaaaccta ccataacttg 480 aagaaaatta ttaaagacaa atatggccta gacgctactg cagtgggaga tgaaggcgga 540 ttcgctccaa atatctcaaa taacaaggac gctctacaaa tcatcaacga tgctatttcc 600 // ID LN889179; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889179; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas pauxillus partial Enolase gene for Enolase, isolate ARC1343 XX KW . XX OS Arachnobas pauxillus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8eb04ccdd05c4d76658ffdfe83be1390. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Arachnobas pauxillus" FT /isolate="ARC1343" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738224" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L129" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L129" FT /protein_id="CUR50010.1" FT /translation="AAVPSGASTGIHEALELRDEVAQDYMGKGVSKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGTETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 190 A; 110 C; 137 G; 160 T; 3 other; gctgctgttc catcgggcgc tagtacaggt attcacgaag ccttagagct ccgagatgaa 60 gttgcacaag attatatggg aaaaggtgtt agtaaagcgg tagataacgt aaataaatcc 120 atcggtccag agttagtcaa gcaaaatttc gatgtcaccc aacaagagga gatcgatgat 180 tttatgatta aattggatgg aaccgaaaat aaatcgaatt ttggtgccaa tgctatttta 240 ggagtgtcgc ttgctgtatg taaagccgga gcagctaaac gaggattgcc tttgtatcga 300 catatagctg atttagcggg aaataaaaat attatccttc cwgtcccagc ttttaacgtc 360 attaatggag gttcacatgc tggaaacaaa ttggcgatgc aagagttcat gattcttcca 420 accggagcgt gttcttttac tgaagccatg aagatgggca ctgaaactta tcataatctc 480 aagaaaatta tcaaagataa atayggyctt gacgccactg ccgtcggaga tgagggtggg 540 ttcgcaccaa atatcacaaa taataaagat gcgcttttaa ttatcaacga tgccatcgcc 600 // ID LN889180; SV 1; linear; genomic DNA; STD; INV; 554 BP. XX AC LN889180; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Idopelma unicolor partial Enolase gene for Enolase, isolate ARC1346 XX KW . XX OS Idopelma unicolor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Idopelma. XX RN [1] RP 1-554 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2cd05571edcaeabd0a374d6c02684bad. XX FH Key Location/Qualifiers FH FT source 1..554 FT /organism="Idopelma unicolor" FT /isolate="ARC1346" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738204" FT CDS <1..>554 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3G6" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3G6" FT /protein_id="CUR50011.1" FT /translation="AAVPSGASTGIHEALELRDENPQDFLGKGVTKAVDNVNKSIGPEL FT VKQNXDVTQQEEIDDFMIKLDGTENKSKFGAXAILGVSLAICKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVIXGGSXAGNKLAMQEFMLLPTGASSFSEAMKMGAETYHNLKKI FT IKDKYGLDATAVGDEGGFAPN" XX SQ Sequence 554 BP; 163 A; 127 C; 142 G; 118 T; 4 other; gcggccgttc cgtcaggggc cagtacgggt attcacgaag ccctggaact aagagacgag 60 aatccgcaag attttctagg caaaggtgtg accaaagctg tagataatgt gaacaaatcc 120 atcggtcccg agttggtgaa acagaatttm gacgttaccc aacaagagga aatcgacgat 180 tttatgatta aactcgatgg cacagagaat aaatccaaat ttggggcgaa kgccatttta 240 ggagtctcgc tggctatatg caaagccggc gctgccaaac gaggagtgcc cttgtacaga 300 catatagctg atttagctgg aaacaaaaac ataattcttc ctgtccccgc ctttaacgtc 360 attawcggag gttcayacgc cggaaacaag ctggccatgc aagagttcat gcttctgccg 420 actggggcgt cctcgttctc ggaagccatg aagatgggcg ccgaaaccta ccacaacctg 480 aagaaaatta ttaaagacaa atatgggctt gacgcgaccg cagtgggaga tgagggcggc 540 ttcgctccaa atat 554 // ID LN889181; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889181; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Perissops cf. apicalis MB-2015 partial Enolase gene for Enolase, isolate DE ARC1361 XX KW . XX OS Perissops cf. apicalis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Perissops. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 38493f78f48a572b13980720aa708555. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Perissops cf. apicalis MB-2015" FT /isolate="ARC1361" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738362" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYC7" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYC7" FT /protein_id="CUR50012.1" FT /translation="AAVPSGASTGIHEALELRDEEPKDYMGKGVSKAVDNVNNSIGPEL FT VKQNFDVTQQEEIDDFMINLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMLLPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNIANNKDALLIINDAIS" XX SQ Sequence 600 BP; 184 A; 147 C; 142 G; 127 T; 0 other; gccgccgtac cctcaggtgc tagtacaggt attcacgaag cgttagaact cagagatgag 60 gagccgaaag actatatggg aaaaggggtg tctaaagccg tcgacaacgt aaacaattct 120 atcggccccg agttagtaaa gcagaatttc gacgtcaccc aacaagagga aatcgacgat 180 tttatgatta acctagacgg tactgaaaat aaatcgaaat tcggagccaa tgccatctta 240 ggggtttcgc ttgccgtttg caaagccggc gcagctaaac gcggagtgcc tctatatcga 300 catatagccg atttagccgg caataaaaat atcatccttc cagtcccggc ttttaacgtc 360 attaacggag gttcgcatgc cgggaataaa ctggccatgc aagaattcat gcttctccca 420 accggcgcat gctcttttac cgaagcaatg aagatgggca gcgaaacgta ccacaattta 480 aaaaaaatca tcaaagacaa gtacggtctt gacgccactg cggtgggaga cgaaggcggg 540 ttcgcgccga acatcgccaa caacaaagac gctcttctga tcataaacga cgccatttcg 600 // ID LN889182; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889182; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mormosintes cf. nodosus MB-2015 partial Enolase gene for Enolase, isolate DE ARC1362 XX KW . XX OS Mormosintes cf. nodosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Mormosintes. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2500b5967c1dc04828452cc20a87fb31. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Mormosintes cf. nodosus MB-2015" FT /isolate="ARC1362" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738356" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L118" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L118" FT /protein_id="CUR50013.1" FT /translation="AAVPSGASTGIHEALELRDEIPEDYLGKGVSKAVDHVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LARNKHLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 186 A; 135 C; 147 G; 132 T; 0 other; gctgcagttc cgtcaggtgc cagtacaggt attcatgaag ccttagaact cagagacgaa 60 attcctgaag actacttagg caagggagtc agcaaggcgg tagatcatgt gaacaaatcg 120 attgggcccg agctagtgaa acagaatttc gatgtcaccc agcaagagga gatcgacgat 180 tttatgatca agctagatgg caccgagaac aaatcgaagt tcggagccaa tgccattttg 240 ggtgtttcgc ttgctgtatg caaagccggt gcggctaaac gaggcgtgcc cctgtatcga 300 catatagctg atttagccag aaataaacat ctcatcctac ccgttccggc tttcaacgtc 360 attaatggtg gctcacatgc cggaaacaag ctggccatgc aagaattcat gatacttccg 420 actggagcat gctctttcac tgaggccatg aaaatgggct cggaaacgta tcacaacctg 480 aaaaaaataa tcaaagacaa gtatgggctt gatgcaactg cagtgggaga tgaaggcggg 540 ttcgcaccga acataacaaa taacaaagac gcccttcaaa taatcaatga tgccattgca 600 // ID LN889183; SV 1; linear; genomic DNA; STD; INV; 573 BP. XX AC LN889183; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Salcus granulatus partial Enolase gene for Enolase, isolate ARC1365 XX KW . XX OS Salcus granulatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Salcus. XX RN [1] RP 1-573 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4c81e8547a5dbf6377c9d934b0ad857d. XX FH Key Location/Qualifiers FH FT source 1..573 FT /organism="Salcus granulatus" FT /isolate="ARC1365" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738283" FT CDS <1..>573 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L193" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L193" FT /protein_id="CUR50014.1" FT /translation="GIHEALELRDEVAQDYMGKGVSKAVDNVNKSIGPELVKQNFDVTQ FT QEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGLPLYRHIADLAGNKNIIL FT PVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGTETYHNLKKIIKDKYGLDA FT TAVGDEGGFAPNIANNKDALLIINDAIA" XX SQ Sequence 573 BP; 184 A; 111 C; 140 G; 137 T; 1 other; ggtattcacg aagccctaga gctcagagat gaagtcgcac aagattatat gggaaaaggg 60 gttagtaaag ctgtagataa tgtgaataaa tcgatcggcc ctgaattggt gaaacaaaat 120 ttcgatgtca ctcaacaaga ggaaatcgac gactttatga ttaaattaga tggaaccgag 180 aataagtcga attttggtgc caacgctatt ctaggagtgt cgcttgcagt gtgcaaagcg 240 ggcgcggcta aacgaggatt gcccctgtat agacatatag ctgatttagc gggaaataaa 300 aatatcatcc ttcctgttcc ggcattcaac gtcattaacg gaggttcaca tgccggaaac 360 aagctggcga tgcaagaatt catgattctt ccaactggag cgtgttcttt tackgaagcc 420 atgaagatgg gcactgaaac ttaccataac ttgaagaaaa ttatcaaaga caaatatggt 480 ctggacgcaa ccgcggtggg agatgaaggc gggttcgcac caaacatcgc gaataacaag 540 gatgcccttt taatcatcaa tgacgctatt gcc 573 // ID LN889184; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889184; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Telaugia subtilis partial Enolase gene for Enolase, isolate ARC1371 XX KW . XX OS Telaugia subtilis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Telaugia. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; eae1666493076d8407bccf671542c3a7. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Telaugia subtilis" FT /isolate="ARC1371" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738210" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZM0" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZM0" FT /protein_id="CUR50015.1" FT /translation="AAVPSGASTGIHEALELRDEVAQDYMGKGVSKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAXXGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 185 A; 121 C; 145 G; 146 T; 3 other; gctgcggttc cctcaggtgc tagtacgggc attcacgaag cgctagaact cagagatgaa 60 gttgcgcaag attatatggg aaaaggagtt agtaaggcgg tagataatgt gaataaatcg 120 atcggccccg aattggtgaa acaaaatttc gatgtaaccc aacaagagga aatcgacgat 180 tttatgatta agttggatgg aaccgagaat aaatcgaatt ttggtgccaa cgctatttta 240 ggagtgtcac ttgctgtctg caaagccggt gcagctaanc naggattgcc cctgtataga 300 catatagctg atttagccgg aaataaaaac atcatccttc ccgttccggc attcaacgtc 360 attaatggag gttcacatgc cggaaacaag ctggcgatgc aagagttcat gattcttcca 420 actggagcgt gttcttttac cgaagccatg aagatgggct ctgaaaccta ccataacctg 480 aagaaaatta tcaaagacaa rtatggtctt gatgcgactg cagtgggaga tgaaggcggg 540 ttcgcgccaa atatcacaaa taacaaggat gcccttttaa tcatcaatga tgccatcgcc 600 // ID LN889185; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889185; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tyrtaeosus sp. ARC1380 partial Enolase gene for Enolase, isolate ARC1380 XX KW . XX OS Tyrtaeosus sp. ARC1380 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tyrtaeosus; unclassified Tyrtaeosus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 795203cbad26c6afb506ce90e5faecd7. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Tyrtaeosus sp. ARC1380" FT /isolate="ARC1380" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737026" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L128" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L128" FT /protein_id="CUR50016.1" FT /translation="AAVPSGASTGIHEALELRDEIPEDYLGKGVSKAVENVNKSLGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGIPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGAFSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 182 A; 139 C; 147 G; 128 T; 4 other; gccgcggttc catcaggtgc cagcacaggt atccacgagg ccttagaact cagagacgaa 60 attccggaag actatcttgg taaaggggtc agtaaagcgg tggaaaatgt gaacaaatcc 120 ctcggccccg agttggttaa acagaatttc gatgtcaccc agcaagagga aatcgacgat 180 tttatgatta agctagatgg taccgagaac aaatccaaat ttggggctaa cgcyatttta 240 ggggtttcgc ttgcagtatg caaagctggg gcrgctaaaa ggggaatccc cytataccga 300 cacatagctg acttagccgg aaataaaaac attattcttc cggtcccggc tttcaacgtg 360 atcaatggag gttcgcacgc cggaaacaag ttggcgatgc aagagttyat gattctcccg 420 actggtgcct tttcttttac cgaagctatg aagatgggca gcgaaactta ccacaaccta 480 aagaaaatca tcaaagacaa gtacggcctc gatgctaccg cagtgggaga cgaaggcggg 540 ttcgcaccga acataaccaa caataaagat gctcttcaga taatcaacga tgccatcgcc 600 // ID LN889186; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889186; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe cf. linnei MB-2015 partial Enolase gene for Enolase, isolate DE ARC1407 XX KW . XX OS Semiathe cf. linnei MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 565e8082d72b2742f82366fc1cdbae82. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Semiathe cf. linnei MB-2015" FT /isolate="ARC1407" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738367" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KY89" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KY89" FT /protein_id="CUR50017.1" FT /translation="AAVPSGASTGIHEALELRDENPQDFLGKGVTKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAICKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMLLPTGACSFTEAMKMGAETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNISNNKDALQIINDAIA" XX SQ Sequence 600 BP; 188 A; 120 C; 141 G; 150 T; 1 other; gccgcggtcc cttcaggtgc tagtacaggt atacacgaag ctttggagct gagagatgag 60 aatccacagg attttcttgg caaaggggta actaaagctg tagacaatgt gaacaaatct 120 atyggccccg agctggtaaa acagaatttc gatgtaaccc aacaggagga gatcgacgat 180 tttatgatta aactcgatgg taccgagaat aaatccaatt ttggtgccaa cgcaatttta 240 ggagtttctc tcgctatatg caaagcaggt gctgctaaac gaggagttcc cctgtatcgg 300 catatagcgg atttagcggg aaataaaaat attattcttc ctgtaccagc tttcaatgtt 360 atcaatggag gttcacatgc tggaaataaa ttggcaatgc aagaattcat gctccttcca 420 actggagctt gctctttcac ggaagccatg aagatgggcg cggaaactta ccacaaccta 480 aagaaaatta ttaaagacaa gtacggccta gatgctactg cggtgggaga tgaaggcgga 540 ttcgctccaa atatttcgaa taacaaggac gctcttcaaa taatcaacga tgcgattgca 600 // ID LN889187; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889187; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC1553 partial Enolase gene for Enolase, isolate DE ARC1553 XX KW . XX OS Cryptorhynchini gen. sp. ARC1553 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 30f22d701be5fe1fc5b805a4d69c4c4d. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Cryptorhynchini gen. sp. ARC1553" FT /isolate="ARC1553" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742677" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L5J5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5J5" FT /protein_id="CUR50018.1" FT /translation="AAVPSGASTGIHEALELRDDVAKDYMGKGVSKAVNNVNNSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGAETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 185 A; 121 C; 145 G; 145 T; 4 other; gctgccgttc cgtcaggtgc tagtacgggc attcacgaag ctctagagct tagagatgac 60 gttgcaaaag attacatggg aaaaggagtc agtaaagcgg taaataacgt gaataattcc 120 atcggccctg agttggtgaa rcaaaatttc gatgtyaccc aacaagagga aatcgacgat 180 tttatgatca aattggaygg aacmgagaat aaatcgaatt ttggtgccaa tgccatttta 240 ggagtgtcgc tcgctgtatg caaagccggt gcggccaaac gagggttgcc cttgtatcga 300 catatagctg atttagctgg aaataaaaac atcattcttc ctgtcccggc tttcaacgtc 360 attaacggag gttcacatgc tggaaacaag ctggcgatgc aagagttcat gattcttccg 420 actggagcat gttcttttac ggaagctatg aagatgggcg ctgaaactta ccacaatctg 480 aagaaaatta tcaaagacaa atacggtctt gacgccacag cagtgggaga cgaaggcgga 540 ttcgcaccaa atatcacaaa taacaaggat gcgcttttaa ttatcaatga tgccatcgcc 600 // ID LN889188; SV 1; linear; genomic DNA; STD; INV; 552 BP. XX AC LN889188; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tychreus sp. ARC1678 partial Enolase gene for Enolase, isolate ARC1678 XX KW . XX OS Tychreus sp. ARC1678 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tychreus; unclassified Tychreus. XX RN [1] RP 1-552 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0f8aaa6700a21a646c9ccf6909922318. XX FH Key Location/Qualifiers FH FT source 1..552 FT /organism="Tychreus sp. ARC1678" FT /isolate="ARC1678" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737022" FT CDS <1..>552 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYG9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYG9" FT /protein_id="CUR50019.1" FT /translation="LRDDNPKDFLGKGVTKAVDHVNKTIGPELVKQNFCVTQQEEIDDF FT MIGLDGTENKSNFGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKNLILPVPAFNV FT INGGSHAGNKLAMQEFMILPTGATSFTEAMKMGAETYHNLKKIIKDKYGLDATAVGDEG FT GFAPNITNNKDALLIINDAIX" XX SQ Sequence 552 BP; 177 A; 115 C; 124 G; 135 T; 1 other; ctcagagacg ataatccgaa agactttcta ggtaaaggcg tgactaaagc tgtagaccat 60 gtaaataaaa ccatcggtcc tgaattagta aaacagaatt tctgtgttac ccaacaggaa 120 gaaatcgatg attttatgat tggactagat ggcaccgaga ataagtcgaa ttttggggcc 180 aacgccattt tgggagtctc cctcgctgtg tgcaaagccg gtgcggccaa acgtggagtg 240 cccttatatc ggcatatagc tgatctagcc ggaaataaaa atctcatcct tccggtcccg 300 gctttcaatg taattaacgg aggttcgcac gctggaaaca aactggcgat gcaagaattc 360 atgattcttc caactggagc cacgtctttt acagaagcca tgaagatggg tgccgaaact 420 taccataatc tgaagaaaat tatcaaagac aagtacggtc ttgatgcaac tgcagtagga 480 gatgaaggcg ggtttgcacc aaacatcaca aataataaag atgcccttct aatcatcaat 540 gatgctatta ra 552 // ID LN889189; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889189; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nototrigonopterus sp. ARC1679 partial Enolase gene for Enolase, isolate DE ARC1679 XX KW . XX OS Nototrigonopterus sp. ARC1679 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nototrigonopterus; unclassified Nototrigonopterus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 62a4f65dc2ea813a6173cb894c5c6443. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Nototrigonopterus sp. ARC1679" FT /isolate="ARC1679" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738291" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3S1" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3S1" FT /protein_id="CUR50020.1" FT /translation="AAVPSGASTGIHEALELRDENPQDFLGKGVTKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGVPLYRXIAD FT LAGNKNIILPVPAFNVINGGSHAXNKLAMQEFMILPXGANSFTEAMKMGAETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINEAIA" XX SQ Sequence 600 BP; 183 A; 133 C; 143 G; 122 T; 19 other; gcagccgttc cgtcaggtgc cagtacaggt atccacgaag ccctagaact cagagacgag 60 aatccccaag acttcctagg taaaggagtg actaaagccg tagacaatgt gaacaagtcc 120 attggccccg agttggtaaa acagaacttc gatgtyaccc aacaagagga aatcgacgat 180 tttatgataa aactggatgg tacggaaaat aartcgaatt ttggggcraa cgccattttr 240 ggagtctcgc ttgccgtgtg caaagcgggc gcdgccaaac gaggggtacc yttgtaccga 300 canatagctg atttagctgg aaayaaaaac ataatccttc cwgttccggc tttcaacgtc 360 attaatggag gttcccatgc yrgaaacaag ctggcgatgc aagarttcat gattcttccg 420 astggggcga actcttttac ggaagccatg aagatgggcg cmgaaaccta ccacaacctr 480 aagaaaatca tcaaagacaa gtacggyctt gacgcaacsg cmgtgggaga tgaaggygga 540 ttcgcaccaa acatcacaaa taacaaggat gctcttctga tcattaacga agctattgcg 600 // ID LN889190; SV 1; linear; genomic DNA; STD; INV; 455 BP. XX AC LN889190; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ectatocyba permutata partial Enolase gene for Enolase, isolate ARC1897 XX KW . XX OS Ectatocyba permutata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ectatocyba. XX RN [1] RP 1-455 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bb74193a0a462e21d7ade98b3c89c46b. XX FH Key Location/Qualifiers FH FT source 1..455 FT /organism="Ectatocyba permutata" FT /isolate="ARC1897" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738247" FT CDS <1..>455 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZ35" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ35" FT /protein_id="CUR50021.1" FT /translation="AAVPSGASTGIHEALELRDEVAQDYMGKGVFKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAXKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGXXLXMQEFMILPTGXCSFXEAMK" XX SQ Sequence 455 BP; 132 A; 82 C; 117 G; 116 T; 8 other; gctgcggtgc cgtcgggcgc tagtacgggt attcacgaag ccctagagct cagagacgaa 60 gtcgcgcaag attatatggg aaaaggagtt tttaaagccg tagataatgt gaataaatcg 120 atcggacctg agttggtgaa acaaaatttc gatgtcaccc aacaagagga aattgacgac 180 tttatgatta agttggacgg gaccgagaat aaatcgaatt ttggtgccaa tgccatttta 240 ggagtgtcgc ttgctgtytg caaagccggt gcagytaaac gaggattacc cytgtataga 300 cacatagctg atttagccgg aaataaaaat atcatccttc ctgtaccggc attcaacgtc 360 attaatggcg gttcacatgc cggaawtwag ctggygatgc aagagtttat gattcttcca 420 actggagsgt gttcttttay ggaagctatg aagat 455 // ID LN889191; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889191; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sybulus sp. ARC1908 partial Enolase gene for Enolase, isolate ARC1908 XX KW . XX OS Sybulus sp. ARC1908 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Sybulus; unclassified Sybulus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f046bcb3303eaf68ca3eecaa29ac34c5. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Sybulus sp. ARC1908" FT /isolate="ARC1908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737016" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L387" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L387" FT /protein_id="CUR50022.1" FT /translation="AAVPSGASTGIHEALELRDEIPDQYMGKGVQKAIDNVNNSLGPEL FT INQNFDVTQQSEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFQEAMKMGSETYHTLKKL FT IKDKYGLDATAVGDEGGFAPNITNNKDALLILNEAIT" XX SQ Sequence 600 BP; 201 A; 133 C; 128 G; 138 T; 0 other; gccgcagttc cttcaggtgc aagcacgggc attcacgaag ccttagagct tagagatgaa 60 attcctgatc aatatatggg aaagggcgtc cagaaagcaa ttgacaacgt aaacaattct 120 ctaggtcctg aattgattaa tcaaaatttt gacgtcaccc aacagtcaga aatagacgaa 180 tttatgatta aactcgatgg aaccgaaaac aagtcaaaat ttggagctaa cgctatttta 240 ggggtatcct tagctgtatg caaagctgga gctgccaagc ggggactacc tttatatcga 300 catatagcgg atttagcggg aaacaaaaat ctcgttttac ctgtccccgc tttcaacgta 360 attaatggag gatcacatgc aggaaacaag ctggcaatgc aagaattcat gattttgccc 420 accggagcaa attccttcca agaagctatg aagatgggca gcgaaacata ccacaccctt 480 aaaaaactta ttaaagataa atacggactg gacgcaactg ccgtgggaga cgaaggtggg 540 tttgccccca acataaccaa caacaaagat gctcttctga ttctcaacga agccatcacc 600 // ID LN889192; SV 1; linear; genomic DNA; STD; INV; 518 BP. XX AC LN889192; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Miocalles sp. 2 MB-2015 partial Enolase gene for Enolase, isolate ARC1918 XX KW . XX OS Miocalles sp. 2 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Miocalles; unclassified Miocalles. XX RN [1] RP 1-518 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d22466f2f6afa446be57a7f2b4f915ab. XX FH Key Location/Qualifiers FH FT source 1..518 FT /organism="Miocalles sp. 2 MB-2015" FT /isolate="ARC1918" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738355" FT CDS <1..>518 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYM0" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYM0" FT /protein_id="CUR50023.1" FT /translation="PQDYVGKGVSKAVNXVNNSIGPELVKQNFDVTQQEEIDDFMIKLD FT GTDNKANFGANAILGVSLAICKAGAAKXGVPLYRHIADLAGNKNIILPVPAFNVINGGS FT HAGNKLAMQEFMILPTGACSFTEAMKMGTETYHNLKKIIKDKXGLDATAVGDEGGFAPN FT ITNNKDALQ" XX SQ Sequence 518 BP; 167 A; 111 C; 118 G; 116 T; 6 other; ccccaagact acgtgggtaa aggggtgagt aaagcagtga ataawgtaaa caattccatc 60 ggccctgaat tggtcaaaca gaattttgat gttacccagc aagaggaaat cgacgatttt 120 atgattaaac tagacggtac cgataataaa gccaatttcg gagctaacgc tattttgggg 180 gtatctttgg ctatatgcaa agctggtgcr gccaaacrag gagtaccttt gtaccgacat 240 atagcagatt tagctggraa taaaaatatt atccttcccg tgccagcttt caacgttatt 300 aayggaggtt cgcacgcagg aaacaaacta gcgatgcaag agttcatgat tcttccaacc 360 ggagcgtgct cgttcacaga agccatgaag atgggcaccg aaacctatca caacctgaag 420 aaaattatca aagacaagta nggccttgat gctactgcag tgggcgatga gggcggcttc 480 gcaccaaaca tcacaaacaa caaagacgcc cttcagat 518 // ID LN889193; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889193; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Enteles vigorsi partial Enolase gene for Enolase, isolate ARC2066 XX KW . XX OS Enteles vigorsii OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Enteles. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 43ba9bef46db0445ec6cfce161c5f57d. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Enteles vigorsii" FT /isolate="ARC2066" FT /mol_type="genomic DNA" FT /db_xref="taxon:1482114" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1I5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1I5" FT /protein_id="CUR50024.1" FT /translation="AAVPSGASTGVHEALELRDEIPEDFLGKGVTKAVDHVNKSIGPEL FT VKQNFDVTQQEEIDDFMINLDGTXNKSNFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVIXGGSHAGNKLAXQEFMILPTGACSFSEAMKMGCETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 182 A; 136 C; 141 G; 136 T; 5 other; gctgctgttc cgtcaggtgc aagcacaggc gtccacgaag ccttagaact aagagacgag 60 attcccgaag attttctcgg taaaggggtc actaaggcgg tagatcatgt aaacaaatca 120 attggccccg agttagtaaa acagaatttc gatgtcaccc agcaggagga aatcgatgat 180 tttatgatta acctagatgg cacckaaaat aaatcgaatt ttggagccaa cgccatttta 240 ggagtatcgc ttgccgtgtg taaagccggt gcggcaaaac gagggcttcc tttgtatcga 300 catatagctg atttggcagg aaataaaaat attatcctcc cygtcccggc cttcaacgtc 360 atcwatggag gttcgcatgc tggaaacaag ctggccaygc aagaattcat gattcttcca 420 accggagcgt gctcgttttc ggaagccatg aaaatgggct gcgaaactta ccataacctg 480 aagaaaatta tcaaagacaa gtacggtctg gacgccactg cagtaggtga tgaaggtggc 540 ttcgcaccaa atatcacaaa taacaaggac gctcttcaaa tcatcaacga cgccatcgcy 600 // ID LN889194; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889194; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus humeralis partial Enolase gene for Enolase, isolate ARC2067 XX KW . XX OS Poropterus humeralis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dd991d8d219ace67828e2e3ba4361704. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Poropterus humeralis" FT /isolate="ARC2067" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742656" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L0Z8" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0Z8" FT /protein_id="CUR50025.1" FT /translation="AAVPSGASTGIHEALELRDDVPEHYLGKGVSKAVDHVNTSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAICKAGAAKRGVPLYRHIAD FT LAGNKHLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIG" XX SQ Sequence 600 BP; 181 A; 135 C; 140 G; 140 T; 4 other; gccgcggtcc cgtcaggtgc tagtacaggt attcacgaag ccttagaact cagagacgat 60 gttccagaac actacctggg caaaggagtc agtaaagcgg tggatcatgt taatacatcg 120 attggtcctg agttagtgaa acaraatttc gatgtcaccc agcaggagga aattgacgac 180 tttatgatta aactagatgg taccgaaaat aaatcgaart ttggagccaa tgccatttta 240 ggagtctcgc ttgctatatg caaagccggc gcggccaaac gaggagtgcc tctgtaccga 300 cacatcgctg atttagctgg aaataaacat ctcatcctcc ccgtcccagc cttcaatgtc 360 attaatggcg gttcacatgc tggcaacaag ctggcratgc aagaattcat gattcttcca 420 actggagcat gctcttttac ggaggccatg aagatgggca gcgaaactta tcataacctg 480 aagaaaatta tcaaagacaa gtatggcctt gacgccactg cggtgggcga tgaaggtggt 540 ttcgcaccaa acatcacaaa taacaaagat gctcttcaaa taatcaayga tgccattgga 600 // ID LN889195; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889195; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhadinomerus sp. ARC2071 partial Enolase gene for Enolase, isolate ARC2071 XX KW . XX OS Rhadinomerus sp. ARC2071 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Aedemonini; Rhadinomerus; unclassified Rhadinomerus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ec4ea6abbe8f6d98305b6cc90520f303. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Rhadinomerus sp. ARC2071" FT /isolate="ARC2071" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736947" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L142" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L142" FT /protein_id="CUR50026.1" FT /translation="AAVPSGASTGVHEALELRDNEPENYLGKGVGKAVENVNXSIGPEL FT VKQDFDVTQQEEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIXLPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFSEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNISNNKDALQIINDAIA" XX SQ Sequence 600 BP; 198 A; 102 C; 133 G; 155 T; 12 other; gcggcagtcc catctggygc cagtacaggt gtgcacgaag ctttggaact tcgagataat 60 gaaccagaaa attatttagg aaaaggcgtt ggcaaagcag tggaaaatgt taatarttcc 120 attggycctg agttggtgaa acaagatttt gatgttacac aacaagagga aatagacgar 180 tttatgatta aactkgacgg aaccgagaat aaatctaaat ttggwgctaa ygcgatttta 240 ggagtctctc ttgctgtatg taaagcaggt gctgcaaaac gaggagtacc tctktatcgg 300 cacatagctg atttagctgg aaataaaaat attatrcttc cggttccagc ttttaacgtc 360 attaatggag gatctcatgc tggaaataaa ctagcaatgc aagaattcat gattctccca 420 actggagcrt gttcttttag tgaagcaatg aaaatgggca gtgaaactta ccacaacctc 480 aagaaaatta ttaargayaa gtacggactt gatgctactg cagtagggga tgaaggtgga 540 tttgctccaa atatcagcaa caataaagat gctcttcaaa tcataaatga tgccatcgcc 600 // ID LN889196; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889196; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Coniferocryptus tamanukii partial Enolase gene for Enolase, isolate ARC2114 XX KW . XX OS Coniferocryptus tamanukii OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Coniferocryptus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ef21ac8f8ccb7a99963ab025fbc4334d. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Coniferocryptus tamanukii" FT /isolate="ARC2114" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738234" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3I3" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3I3" FT /protein_id="CUR50027.1" FT /translation="AAVPSGASTGIHEALELRDEIPDQYMGKGVQKAVENVNNAIGPEL FT VKQNFDVTQQEDIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT IAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFLEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIT" XX SQ Sequence 600 BP; 203 A; 113 C; 131 G; 149 T; 4 other; gctgcagttc cttcaggtgc cagcacaggt attcatgaag ctctagagct tagagacgaa 60 attccagatc agtatatggg aaaaggcgtt cagaaagcag tggaaaatgt aaataatgcc 120 ataggccctg aattggtwaa gcaaaatttt gatgttactc aacaggaaga catagatgaa 180 tttatgatta aacttgatgg caccgaaaat aagtcgaaat ttggagccaa cgccatttta 240 ggagtatcgc tagcagtatg caaagctggn gctgccaagc gaggagtccc tttataccgc 300 catattgcag acatagcagg aaacaaaaat atcattttac ctgtccccgc tttcaatgta 360 attaatggag ggtcacatgc aggaaataag ctggctatgc aagaattcat gattttacca 420 actggtgcaa attcgttcct ggaagctatg aagatgggct ccgaaacwta ycacaatctt 480 aaaaaaatca ttaaagacaa atatggattg gacgccaccg cggtaggaga cgaaggcgga 540 tttgcgccta acataactaa taacaaagat gctcttctaa ttattaacga tgctattact 600 // ID LN889197; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889197; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paromalia setiger partial Enolase gene for Enolase, isolate ARC2166 XX KW . XX OS Paromalia setiger OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Paromalia. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1b1356e681b81d0928cc489f70b12ae2. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Paromalia setiger" FT /isolate="ARC2166" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738273" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYH9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYH9" FT /protein_id="CUR50028.1" FT /translation="AAVPSGASTGIHEALELRDDNPQEYLGKGVGKAVNHVNESIGPAL FT VKESFDVTQQEEIDEFMIKLDGTDNKANFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 182 A; 149 C; 149 G; 120 T; 0 other; gccgcagtac catcgggtgc cagtaccggg atccatgaag ctttggagct gcgagacgat 60 aatccacaag agtacctcgg caaaggagta ggcaaggcgg taaaccacgt aaacgagtcc 120 atcggtcccg cattggtaaa agagagtttc gacgttaccc agcaagaaga aatcgacgaa 180 tttatgatca aactagatgg caccgataat aaagctaatt tcggggccaa cgccattttg 240 ggggtgtcgc tggccgtatg caaagccggt gccgccaaac gtggattacc tttgtaccgg 300 cacatagctg acttagctgg aaataaaaac attatccttc cagtaccggc tttcaacgtc 360 attaatggag gttcgcatgc cggaaacaag ctggcgatgc aagagtttat gatccttcca 420 actggagcgt gctctttcac agaagccatg aagatgggca gcgaaaccta ccacaacttg 480 aagaaaatta tcaaagacaa atacggcctg gacgccactg cagtaggcga tgaaggcggg 540 ttcgcaccga acatcaccaa caacaaagac gctcttcaaa tcatcaacga tgccattgcc 600 // ID LN889198; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889198; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Synacalles dorsalis partial Enolase gene for Enolase, isolate ARC2168 XX KW . XX OS Synacalles dorsalis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Synacalles. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fda6c4c128b0301949ea3605901d1a0b. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Synacalles dorsalis" FT /isolate="ARC2168" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738285" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L145" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L145" FT /protein_id="CUR50029.1" FT /translation="AAVPSGASTGIHEALELRDDIAKDYMGKGVGKAVANVNDSIGPEL FT VKQCFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKHIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAXKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 177 A; 143 C; 153 G; 124 T; 3 other; gcwgcggtac cgtcaggtgc cagtacaggc attcacgagg ccttggaact gcgagacgat 60 attgcaaagg actayatggg taaaggagtt ggtaaagccg tagccaatgt gaatgattcc 120 attggccccg agctggtgaa gcaatgcttc gatgtcaccc agcaggaaga aatagacgat 180 ttcatgatta aactggatgg cactgagaat aagtcgaact ttggggccaa tgccatttta 240 ggagtgtcgc tggcggtatg caaagcaggt gcggccaaac gaggccttcc cttgtatcgc 300 catatagccg acttagcagg aaataaacat attatccttc ctgtaccggc cttcaacgtc 360 atcaatggag gttcccatgc cggaaacaag ttggcgatgc aggaattcat gattctacca 420 actggagcat gctcttttac cgaagccrtg aagatgggaa gcgaaactta ccacaacctg 480 aagaaaatta tcaaagacaa atacggcctt gacgccaccg cggtgggaga cgaaggcggg 540 ttcgcaccaa acatcaccaa caacaaagac gccctactga tcatcaacga tgcaattgcc 600 // ID LN889199; SV 1; linear; genomic DNA; STD; INV; 555 BP. XX AC LN889199; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Crisius fasciculatus partial Enolase gene for Enolase, isolate ARC2179 XX KW . XX OS Crisius fasciculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Crisius. XX RN [1] RP 1-555 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; be1b3e7213e9bfbd7dccf5d5074ca8bf. XX FH Key Location/Qualifiers FH FT source 1..555 FT /organism="Crisius fasciculatus" FT /isolate="ARC2179" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738236" FT CDS <1..>555 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1B3" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1B3" FT /protein_id="CUR50030.1" FT /translation="ELRDNIPQDYVGKGVSKAIDNVNKSIGPELVKQNFDVTQQEEIDD FT FMIKLDGTDNKSNFGANAILGISMAICKAGAAKRGVPLYRHIADLCGNKHIILPVPAFN FT VINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGTETYHTLKKIIKDKYGLDATAVGDE FT GGFAPNITNNKDALVIINDAIA" XX SQ Sequence 555 BP; 168 A; 132 C; 136 G; 118 T; 1 other; gaactgcgag acaatattcc gcaagactac gtaggcaagg gagtcagcaa agcgatagac 60 aatgtgaaca aatccattgg ccccgagttg gtaaaacaga atttcgatgt tacccaacag 120 gaggagatcg acgattttat gatcaaacta gacggcaccg ataataaatc gaattttggg 180 gccaatgcca ttttaggaat atcgatggcc atatgcaaag ccggcgcggc caaacgaggg 240 gtacctttgt atcgccatat agccgattta tgcggaaata aacatattat cctscctgtt 300 ccggccttca acgtcattaa tggcggttcg catgccggga acaagctggc gatgcaagaa 360 ttcatgattc ttccaactgg ggcgtgctct tttacagagg ccatgaagat gggcaccgaa 420 acctaccaca ccctgaagaa aattatcaaa gacaagtacg gcctcgacgc cactgctgtg 480 ggagacgaag gggggtttgc ccctaacatc acgaataaca aagacgctct ggtgatcatc 540 aatgacgcca tcgcc 555 // ID LN889200; SV 1; linear; genomic DNA; STD; INV; 516 BP. XX AC LN889200; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dermothrius farinosus partial Enolase gene for Enolase, isolate ARC2182 XX KW . XX OS Dermothrius farinosus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Dermothrius. XX RN [1] RP 1-516 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 10098aded00cd0910f82181ab135f8d4. XX FH Key Location/Qualifiers FH FT source 1..516 FT /organism="Dermothrius farinosus" FT /isolate="ARC2182" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738245" FT CDS <1..>516 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZN4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZN4" FT /protein_id="CUR50031.1" FT /translation="GVSKAXXNVXNSIGPEXLKQNFDVTQQEEIDDFMIKXBGTENKSQ FT FGANAILGVSLAVCKAXAAKRGXPLXXHIXDLXGNKNIILPVPAFNVINGGSHAGXKLA FT MQEFMXLPTGACSFTEAMKMGSETYHNLKKIIKDKYGLDATAVGXEGGFAPBITNNKDA FT LLIINDAIA" XX SQ Sequence 516 BP; 155 A; 125 C; 111 G; 104 T; 21 other; ggggtragca aagcartaks taatgtcarc aattcsatcg gccccgaatk gctaaaacaa 60 aatttcgacg ttacccaaca rgaagaaatc gacgatttta tgatcaaack aratggcacc 120 gagaataaat cgcagtttgg ggccaatgcc attttagggg tatcgctagc ggtatgcaaa 180 gcakgcgcgg ctaaacgggg aayacctctg tawcsccata takctgattt asctggaaac 240 aagaatatta tcctcccagt accagctttc aacgtgatta acggaggttc ccatgccggc 300 macaaactgg cgatgcaaga gttcatgawc cttcccacag gcgcgtgctc ttttaccgaa 360 gccatgaaga tgggttccga aacttaccac aacctgaaga aratcatcaa ggataagtac 420 ggccttgacg ctaccgcggt aggcgakgaa ggcggcttcg cacccracat cacaaataac 480 aaagacgctc tgctgattat caacgatgca atcgcc 516 // ID LN889201; SV 1; linear; genomic DNA; STD; INV; 393 BP. XX AC LN889201; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini cf. Kirschia sp. ARC2346 partial Enolase gene for Enolase, DE isolate ARC2346 XX KW . XX OS Cryptorhynchini cf. Kirschia sp. ARC2346 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-393 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0c0eb7a89f23cffbd543c17236b99a59. XX FH Key Location/Qualifiers FH FT source 1..393 FT /organism="Cryptorhynchini cf. Kirschia sp. ARC2346" FT /isolate="ARC2346" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742670" FT CDS <1..>393 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L147" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L147" FT /protein_id="CUR50032.1" FT /translation="NKSKFXANAJLGIXLAVCXAGAAXRGMPLXRHIADLACNKHIVLP FT VPAFNVINGGSHAGNKLAMQEFMILPTGATSFKEAMKMGSETYHTLKKIIKDKYGLDAT FT AVGDEGGFAPNITNNKDALLIINBAIA" XX SQ Sequence 393 BP; 129 A; 84 C; 80 G; 90 T; 10 other; aataagtcga aatttgsagc aaatgccmtt ctgggaataw ctttggcagt atgcaragcr 60 ggtgctgcca ascgaggaat gcctttayac cgacatatag cagacttagc atgtaacaag 120 catatcgttt tacctgttcc agcattcaac gtgatcaatg gaggatcaca tgcmggaaat 180 aaactggcga tgcaagaatt catgattcta cctaccggag caacttcgtt taaagaagcc 240 atgaagatgg gcagcgarac ctaccatacc ctcaaaaaaa tcattaaaga caaatacgga 300 ttggacgcaa ctgccgttgg agatgaaggt ggatttgctc ccaacataac taacaacaaa 360 gacgctctgc taattattaa cratgccatt gcc 393 // ID LN889202; SV 1; linear; genomic DNA; STD; INV; 579 BP. XX AC LN889202; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus lapathi partial Enolase gene for Enolase, isolate ARC2551 XX KW . XX OS Cryptorhynchus lapathi (poplar-and-willow borer) OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus. XX RN [1] RP 1-579 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 242c0e0e6b913f61aa2979317eee5eee. XX FH Key Location/Qualifiers FH FT source 1..579 FT /organism="Cryptorhynchus lapathi" FT /isolate="ARC2551" FT /mol_type="genomic DNA" FT /db_xref="taxon:201897" FT CDS <1..>579 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYA2" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYA2" FT /protein_id="CUR50033.1" FT /translation="STGIHEALELRDEIPDQYMGKGVQKAVDNVNNAIGPELVKQNFDV FT TQQEEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGIPLYRHIADLAGNKNL FT ILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFIEAMKMGSETYHTLKKIIKDKYGL FT DATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 579 BP; 205 A; 115 C; 129 G; 130 T; 0 other; agcacaggta ttcacgaagc tcttgagctt agagacgaga tcccagatca gtatatggga 60 aaaggagtac agaaagcagt agataatgta aataatgcca taggccctga attggtaaag 120 caaaattttg atgtcaccca acaggaagaa atcgacgaat ttatgattaa acttgatggc 180 acggaaaata agtcgaaatt tggagccaac gctattttag gagtgtctct agcagtatgc 240 aaagccggtg ctgccaaacg aggcatccct ttataccgac acatagcgga tttagcagga 300 aacaagaacc tcatattacc cgtcccggct ttcaatgtga ttaatggagg atcccatgca 360 ggaaacaaac tggcgatgca agaattcatg attttaccaa ccggagcgaa ttcattcata 420 gaagctatga agatgggaag cgaaacctat cataccctta aaaaaataat taaagacaaa 480 tacggattgg acgccactgc tgtgggagat gaaggcggat ttgcgcccaa cataaccaac 540 aacaaagatg ctttgcaaat tattaacgat gccattgcc 579 // ID LN889203; SV 1; linear; genomic DNA; STD; INV; 546 BP. XX AC LN889203; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Aclees indignus partial Enolase gene for Enolase, isolate ARC2557 XX KW . XX OS Aclees indignus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Aclees. XX RN [1] RP 1-546 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ad16c9d3eb225dce921853279ef89a21. XX FH Key Location/Qualifiers FH FT source 1..546 FT /organism="Aclees indignus" FT /isolate="ARC2557" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738218" FT CDS <1..>546 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L5L0" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5L0" FT /protein_id="CUR50034.1" FT /translation="DNIPDQYLGKGVSQAVENVNNSIGPELVKQDFDVTQQEEIDDFMI FT KLDGTENKSNFGANAILGVSLAICKAGAAKRGVPLYRHIADLAGNKNLILPVPAFNVIN FT GGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHTLKKIIKDKYGLDATAVGDEGGF FT APNITNNKDALLIINDAIA" XX SQ Sequence 546 BP; 156 A; 130 C; 137 G; 111 T; 12 other; gacaacatcc ccgatcagta cctgggaaaa ggggtgagtc aggcggttga aaatgtcaac 60 aactccatcg gtcccgagtt ggtaaagcag gactttgatg tcactcaaca agaggaaatc 120 gacgatttca tgattaagct cgatggaacc gagaataagt caaattttgg cgcgaacgct 180 attctaggag tatctttggc gatctgcaaa gctggagcwg craaaagggg cgtgcccttr 240 taccgccaca tagctgacct agcaggaaac aagaacctwa tccttccggt gccagccttt 300 aatgtgatca acggagggtc ycatgcrgga aataagcttg ctatgcagga attcatgatt 360 cttcccactg gygcatgctc tttcacygaa gccatgaaga tgggcagcga gacttaccac 420 accctgaaga aaattattaa agacaagtay ggcctggacg ccaccgcrgt gggagatgag 480 ggagggttcg cccccaacat caccaacaac aaggacgcyt tgctgattat caacgatgcm 540 atcgcc 546 // ID LN889204; SV 1; linear; genomic DNA; STD; INV; 588 BP. XX AC LN889204; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Niphades cf. costatus MB-2015 partial Enolase gene for Enolase, isolate DE ARC2563 XX KW . XX OS Niphades cf. costatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Aminyopini; Niphades. XX RN [1] RP 1-588 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e4297a48398f4d1d28ed71272d151f31. XX FH Key Location/Qualifiers FH FT source 1..588 FT /organism="Niphades cf. costatus MB-2015" FT /isolate="ARC2563" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738360" FT CDS <1..>588 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYI4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYI4" FT /protein_id="CUR50035.1" FT /translation="SGAXTGVHEALELRDEIPDQYMGKGVSXAVNNVNTLIAPELVKQS FT FDVTQQEEIDEFMIKLDGTDNKANFGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGN FT KNIILPVPAFNVINGGEHAGNKLAMQEFMLIPSGATSFTEAMKMGSETYHNLKKIIKDK FT YGLDATAVGDEGGFAPNITNNKDALAIINDAIA" XX SQ Sequence 588 BP; 187 A; 95 C; 134 G; 163 T; 9 other; tcgggtgcta stacwggtgt tcatgaagct ttagaactaa gggatgaaat yccagatcag 60 tacatgggaa aaggagtgtc araagcagtt aataatgtaa atactctcat tgccccagag 120 ttggtaaaac aaagctttga tgttactcag caggaggaaa tcgatgagtt tatgattaag 180 ctggatggta ctgataacaa agcaaatttt ggcgccaatg ctattttagg tgtgtccttg 240 gctgtgtgta aagccggtgc tgctaaaaga ggtgttccat tatatcgaca tatagctgay 300 ctcgctggca acaaaaacat tattcttcct gttcccgctt ttaatgtaat aaatggagga 360 gaacatgctg gaaataagtt agctatgcaa gagtttatgc ttattccaag tggagcaact 420 tcktttactg aagckatgaa gatgggcagt gaaacctatc acaatcttaa gaaaatcatt 480 aaagataagt aygggcttga tgctactgca gtaggagatg aaggaggctt cgcyccaaac 540 atcacaaata ataaagatgc tcttgctatc attaatgatg ctattgcg 588 // ID LN889205; SV 1; linear; genomic DNA; STD; INV; 279 BP. XX AC LN889205; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Heilipodus sp. ARC2566 partial Enolase gene for Enolase, isolate ARC2566 XX KW . XX OS Heilipodus sp. ARC2566 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Heilipodus; unclassified Heilipodus. XX RN [1] RP 1-279 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b7e2ad04708749af951438876094a358. XX FH Key Location/Qualifiers FH FT source 1..279 FT /organism="Heilipodus sp. ARC2566" FT /isolate="ARC2566" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736944" FT CDS <1..>279 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3T5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3T5" FT /protein_id="CUR50036.1" FT /translation="NKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKM FT GXETYHNLKKMIKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 279 BP; 82 A; 82 C; 65 G; 48 T; 2 other; aataaaaatt taatcctgcc cgtacccgcg tttaacgtca tcaatggtgg atcccacgcg 60 ggcaacaaac tggcgatgca agagttcatg attctcccca ccggagcgtg ctccttcacc 120 gaagccatga agatgggcak cgagacytac cacaacctca agaaaatgat caaggacaag 180 tacgggcttg acgccaccgc cgtgggagac gaaggcgggt tcgcgccgaa catcaccaac 240 aacaaagacg cccttcagat tattaacgat gccatcgcc 279 // ID LN889206; SV 1; linear; genomic DNA; STD; INV; 198 BP. XX AC LN889206; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Hylobius piceus partial Enolase gene for Enolase, isolate ARC2569 XX KW . XX OS Hylobius piceus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Hylobius. XX RN [1] RP 1-198 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 278c937a846ac39f5dd0c5cde77d4bbf. XX FH Key Location/Qualifiers FH FT source 1..198 FT /organism="Hylobius piceus" FT /isolate="ARC2569" FT /mol_type="genomic DNA" FT /db_xref="taxon:1002011" FT CDS <1..>198 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZ49" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ49" FT /protein_id="CUR50037.1" FT /translation="EFMILPTGXCXXXEAMXMXSEXYHNLKKIIKDKYGLDATAVGDEG FT GFAPNITNNKDALLIINDAIA" XX SQ Sequence 198 BP; 61 A; 48 C; 39 G; 41 T; 9 other; gaattcatga ttctccccac cggckcatgc tmctntamcg aagcsatgaw gatggsaagc 60 gagwcgtacc acaaycttaa gaaaatcatt aaagacaagt atggacttga cgccactgca 120 gttggagatg aaggaggctt cgcccctaat atcactaaca acaaagacgc cctattgatt 180 atcaatgatg ccatcgcc 198 // ID LN889207; SV 1; linear; genomic DNA; STD; INV; 381 BP. XX AC LN889207; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC2604 partial Enolase gene for Enolase, isolate DE ARC2604 XX KW . XX OS Cryptorhynchini gen. sp. ARC2604 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-381 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0d59b4a74a83320038bca4b87482f83b. XX FH Key Location/Qualifiers FH FT source 1..381 FT /organism="Cryptorhynchini gen. sp. ARC2604" FT /isolate="ARC2604" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742678" FT CDS <1..>381 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3A5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3A5" FT /protein_id="CUR50038.1" FT /translation="XGAXAILXVSLAVCKAGAAKRGVPLYRHIADLAGNKNIILPVPAF FT NVINGGEHAGNKLAMQEFMIIPTGATSFTEAMKMGSETYHNLKKIIKDKYGLDATAVGD FT EGGFAPNITNNKDALAIVNDAIA" XX SQ Sequence 381 BP; 115 A; 91 C; 84 G; 85 T; 6 other; yttggtgccw acgcgatttt akgagtgtcc ttggccgttt gcaaagctgg cgctgctaaa 60 agaggtgtgc ctctctatag acatatagca gatcttgctg gcaacaagaa catcatcctt 120 cctgtccccg cttttaatgt aataaayggc ggagagcatg ctggaaataa gytggctatg 180 caagaattca tgattatccc cactggagcm acttccttca ccgaagccat gaagatgggc 240 agcgaaactt accacaacct caaaaaaatt atcaaagaca agtacggact cgatgccact 300 gcagtaggag acgaaggagg cttcgcccca aatataacaa acaacaaaga cgctctggcc 360 atcgttaatg atgcaatcgc t 381 // ID LN889208; SV 1; linear; genomic DNA; STD; INV; 516 BP. XX AC LN889208; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acallophilus sp. ARC2607 partial Enolase gene for Enolase, isolate ARC2607 XX KW . XX OS Acallophilus sp. ARC2607 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acallophilus; unclassified Acallophilus. XX RN [1] RP 1-516 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9374e92b54ba3cdd338afc21fefd3383. XX FH Key Location/Qualifiers FH FT source 1..516 FT /organism="Acallophilus sp. ARC2607" FT /isolate="ARC2607" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736917" FT CDS <1..>516 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYN5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYN5" FT /protein_id="CUR50039.1" FT /translation="GVGKAVANVNNSIGPELVKQNFDVTXQEEIDEFMIKLDGTDNKAK FT FGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKNIILPVPAFNVINGGSHAGNKLA FT MQEFMLLPTGACSFTEAMKMGSETYHNLKKIIKDKYGLDATAVGDEGGFAPNITNNKDA FT LQIINDAIA" XX SQ Sequence 516 BP; 164 A; 118 C; 120 G; 112 T; 2 other; ggagtcggca aggcggtggc caatgtgaat aattccattg gcccggagtt agtgaaacag 60 aatttcgatg ttacmcasca ggaagaaatc gacgaattta tgataaaact tgacggtacc 120 gataataaag cgaaatttgg cgccaatgcc attttaggag tatctctagc tgtatgcaaa 180 gccggtgctg ccaaacgagg agtccccttg tatcgccaca tagctgattt agccggaaac 240 aaaaacatta tccttccagt gcccgccttc aacgttatta atggaggttc acatgcagga 300 aacaagctgg ctatgcaaga atttatgctt cttccgactg gagcatgctc ttttacggag 360 gcaatgaaaa tgggcagcga aacctaccac aacctaaaga aaattatcaa agataaatat 420 ggcttggacg ccacagcagt gggagatgaa ggcggattcg cgccgaacat aaccaacaac 480 aaagacgccc tccagatcat caacgatgcc atcgcc 516 // ID LN889209; SV 1; linear; genomic DNA; STD; INV; 285 BP. XX AC LN889209; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paramecops (sensu lato) sp. ARC2615 partial Enolase gene for Enolase, DE isolate ARC2615 XX KW . XX OS Paramecops (sensu lato) sp. ARC2615 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Paramecops. XX RN [1] RP 1-285 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f69503676c303de9245297844e1a4244. XX FH Key Location/Qualifiers FH FT source 1..285 FT /organism="Paramecops (sensu lato) sp. ARC2615" FT /isolate="ARC2615" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738372" FT CDS <1..>285 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1J9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1J9" FT /protein_id="CUR50040.1" FT /translation="AGNKNLILPVPAFNVXNGGSHAGNKLAMQEFMILPTGXCSFTEAM FT KMGSETYHNLKKIIKDKYGLDATAVXDEGGFXPNITNNXDALLIINDAIA" XX SQ Sequence 285 BP; 86 A; 79 C; 57 G; 57 T; 6 other; gccggaaaca agaaccttat cctccccgtt cctgctttta acgtcawcaa cggaggatcc 60 cacgccggaa acaaattggc aatgcargaa ttcatgatcc tccccaccgg ascatgctcc 120 ttcaccgagg ccatgaagat gggcagcgag acttaccaca atctcaagaa aattattaaa 180 gacaagtatg gacttgatgc aaccgcagta rgagacgaag ggggcttckc cccgaatatt 240 actaacaaca asgacgccct tctgatcatc aatgatgcca ttgct 285 // ID LN889210; SV 1; linear; genomic DNA; STD; INV; 477 BP. XX AC LN889210; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Praodes sp. ARC2619 partial Enolase gene for Enolase, isolate ARC2619 XX KW . XX OS Praodes sp. ARC2619 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Praodes; unclassified Praodes. XX RN [1] RP 1-477 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 83fd3c867a90b68f73eb71a6ea1af9e7. XX FH Key Location/Qualifiers FH FT source 1..477 FT /organism="Praodes sp. ARC2619" FT /isolate="ARC2619" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737002" FT CDS <1..>477 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L114" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L114" FT /protein_id="CUR50041.1" FT /translation="GPELVKQBFXVTQQEZIDEFMIKLDGTDXKSKFGANAILGVSLAV FT CKAGAAKRGLPLYRHIADLAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACS FT FSEAMKMGSETYHNLKKIIKDKYGLDATAVGDEGGFAPNISNNKDALQIINDAIA" XX SQ Sequence 477 BP; 161 A; 93 C; 96 G; 122 T; 5 other; ggccccgarc tggtaaaaca aratttckat gtcacacaac aagaasaaat cgacgagttt 60 atgattaaac ttgacggaac cgacartaaa tctaaatttg gtgctaacgc gattttaggc 120 gtctctcttg ctgtatgcaa agccggtgct gcaaaacgag gattacctct atatcgacac 180 atagctgatt tagctggtaa caaaaatatt atccttccag ttccagcatt taacgtcatt 240 aatggaggat ctcacgctgg aaataaacta gcgatgcaag aattcatgat tcttccaact 300 ggagcatgtt cttttagtga agcaatgaaa atgggaagtg aaacttacca taacctcaag 360 aaaattatca aagacaagta cgggcttgat gctaccgcag tgggggatga aggtggattt 420 gctccaaata ttagcaacaa taaagatgcc cttcagatca taaatgatgc aatagcc 477 // ID LN889211; SV 1; linear; genomic DNA; STD; INV; 522 BP. XX AC LN889211; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulus sp. ARC2631 partial Enolase gene for Enolase, isolate ARC2631 XX KW . XX OS Eubulus sp. ARC2631 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulus; unclassified Eubulus. XX RN [1] RP 1-522 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f2b0630ee1e6b9accaf2fa6227684222. XX FH Key Location/Qualifiers FH FT source 1..522 FT /organism="Eubulus sp. ARC2631" FT /isolate="ARC2631" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736925" FT CDS <1..>522 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L160" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L160" FT /protein_id="CUR50042.1" FT /translation="GKGVXKAVDXVXNSIGPELVNQNFDVTQQEDIDEFMIKLDGTENK FT SKFGANAILGVSLAXCKAGAAKRGVPLYRHIADLAGNKNIVLPVPAFNVINGGSHAGNK FT LXMQEFMILPTGANSFQEAMRMGSETYHNLKKIIKDKYGLDATAVGDEGGFAPNITNNK FT DALLIINDAIA" XX SQ Sequence 522 BP; 176 A; 102 C; 119 G; 119 T; 6 other; ggaaaaggag ttaawaaggc cgtagacart gtcmataact ctattggtcc cgaactggta 60 aatcagaact ttgatgtgac tcaacaagaa gatattgatg agtttatgat taaattagac 120 ggcacggaaa ataaatcgaa atttggcgcc aatgccattt taggagtgtc gttggcagwa 180 tgcaaagctg gggctgctaa acgaggagtg ccattatata gacatatagc agacttggca 240 ggaaataaga acatcgtcct accggtccct gcgtttaacg tcattaatgg aggttcacat 300 gccggaaaca aactakcaat gcaggaattt atgattctgc ccactggagc aaactcattt 360 caggaagcta tgagaatggg tagcgaaaca taccataatc tsaagaaaat aattaaagat 420 aaatacggat tagacgccac tgcagtgggg gacgaaggtg gcttcgcgcc taacatcacc 480 aacaacaaag atgcccttct aatcatcaac gatgccatcg cc 522 // ID LN889212; SV 1; linear; genomic DNA; STD; INV; 594 BP. XX AC LN889212; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Chalcodermus cf. calidus MB-2015 partial Enolase gene for Enolase, isolate DE ARC2632 XX KW . XX OS Chalcodermus cf. calidus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Sternechini; Chalcodermus. XX RN [1] RP 1-594 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e5c683a343d922ba118668a47afbb15f. XX FH Key Location/Qualifiers FH FT source 1..594 FT /organism="Chalcodermus cf. calidus MB-2015" FT /isolate="ARC2632" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738344" FT CDS <1..>594 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3J8" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3J8" FT /protein_id="CUR50043.1" FT /translation="VPSGASTGVHEALELXDEIPDQYLGKGVSKAVEHVNNCIGPELVK FT ENLDVTQQEAIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIADLA FT GNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFREAMKMGSETYHTLKKIIK FT DKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 594 BP; 196 A; 117 C; 131 G; 142 T; 8 other; gttccatcag gcgcaagyac aggtgttcay gaagctttag aacttasaga tgaaattcct 60 gatcaatacc taggcaaagg agtaagtaag gcagtcgaac atgtaaacaa ttgcattggt 120 cccgagctgg taaaggaaaa tcttgatgtt acccarcaag aagcaatcga cgaatttatg 180 attaaactag atggaactga aaataagtca aaatttggtg ctaatgcaat mctgggagtg 240 tccctggcwg tatgcaaagc aggtgccgcc aaaagaggtg taccgcttta cagacacata 300 gctgatttgg ctggaaacaa gaatctcatt cttcctgttc cmgcgtttaa cgtaataaac 360 ggtggttctc atgcaggtaa taaattagct atgcaagagt ttatgattct tcccactggg 420 gcaaacagct tccgtgaagc catgaaaatg ggtagcgaaa cataccatac cctcaagaaa 480 ataatcaaag ataaatatgg acttgatgcc actgccgtag gagacgaagg aggatttgcc 540 ccaaatatca ctaacaataa ggatgccctt ytgatcatca acgacgccat tgct 594 // ID LN889213; SV 1; linear; genomic DNA; STD; INV; 546 BP. XX AC LN889213; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Odosyllis congesta partial Enolase gene for Enolase, isolate ARC2930 XX KW . XX OS Odosyllis congesta OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Gasterocercini; Odosyllis. XX RN [1] RP 1-546 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e99d4f60e5213e03006cb6b4406bd610. XX FH Key Location/Qualifiers FH FT source 1..546 FT /organism="Odosyllis congesta" FT /isolate="ARC2930" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738261" FT CDS <1..>546 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYJ4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYJ4" FT /protein_id="CUR50044.1" FT /translation="DENXQDFLGXGVTKAVDNVNRSIGPELVKQNFDVTQQEEIDEFMI FT KLDGTENKSNFGANAILGVSLAVCKAGAAKRGVPLYRHIADLCGNKNIILPVPAFNVIN FT GGSHAGNKLAMQEFMLLPTGACSFSDAMKMGAETYHNLKKIIKDKYGLDATAVGDEGGF FT APNISNNKDALQIINDAIA" XX SQ Sequence 546 BP; 173 A; 108 C; 119 G; 140 T; 6 other; gacgagaacc macaagattt tctcggaraa ggagtgacta aagctgttga caatgtaaat 60 agatccatcg gtcccgagtt agtcaaacaa aatttcgatg tcactcaaca ggaagaaatc 120 gacgaattta tgattaaact cgatggaact gagaataaat ccaattttgg ggctaatgcg 180 attttaggag tctcgctcgc tgtrtgtaaa gccggtgctg ctaaacgagg agttcccctg 240 taccggcata tagccgattt atgcggaaay aagaatatta tccttcctgt cccagctttt 300 aacgttatca atgggggttc acacgctgga aataaattgg cgatgcaaga attcatgctt 360 cttccaactg grgcytgctc tttctcggat gccatgaaaa tgggtgcgga aacttaccat 420 aacctaaaga aaattattaa agacaagtat ggtctagacg ctaccgcagt aggagatgaa 480 ggcggatttg ccccaaatat ctcaaataac aaggatgctc ttcaaataat caatgatgcc 540 attgca 546 // ID LN889214; SV 1; linear; genomic DNA; STD; INV; 351 BP. XX AC LN889214; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus waterhousei partial Enolase gene for Enolase, isolate ARC3486 XX KW . XX OS Poropterus waterhousei OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. XX RN [1] RP 1-351 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 735fc73b4b8bac448d4598d4a1559d88. XX FH Key Location/Qualifiers FH FT source 1..351 FT /organism="Poropterus waterhousei" FT /isolate="ARC3486" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738278" FT CDS <1..>351 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L158" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L158" FT /protein_id="CUR50045.1" FT /translation="LAICKAGAAKRGVPLYRHIADLAGNXHLILPVPAFNVINGGSHAG FT NKLAMQEFMILPTGACSFTEAMKMGXETYHNLKKIIKDKYGLDATAVGDEGGFAPNITN FT NKDALQIINDAIG" XX SQ Sequence 351 BP; 105 A; 85 C; 75 G; 84 T; 2 other; cttgctatat gcaaggccgg tgccgccaaa cgaggagtgc ccttgtatcg ccatattgct 60 gatttagccg gaaataakca tctcatcctt cccgtaccgg ctttcaatgt cattaatggc 120 ggttcgcatg ctggaaacaa gcttgcaatg caagaattca tgattcttcc aactggagca 180 tgctctttta cggaagccat gaagatgggc ascgaaactt accacaacct gaagaaaatt 240 atcaaagaca agtatggcct tgacgccact gcagtaggag atgaaggtgg tttcgcaccc 300 aacatcacaa ataacaaaga tgcccttcaa atcatcaacg atgctattgg a 351 // ID LN889215; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889215; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paleticus subereus partial Enolase gene for Enolase, isolate ARC3487 XX KW . XX OS Paleticus subereus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Paleticus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f7ba6ada0a17ec3e49e86deb98f036d2. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Paleticus subereus" FT /isolate="ARC3487" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738263" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1C5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1C5" FT /protein_id="CUR50046.1" FT /translation="AAVPSGASTGIHEALELXDEIPEBYLGXGVTKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDDFMINLDGTENKSKFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGCETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 182 A; 140 C; 134 G; 137 T; 7 other; gctgccgttc cgtcnggtgc tagtacaggt attcacgarg ccttagaact casagacgar 60 attccggaar actatctygg traaggagtc actaaagccg tcgataatgt aaacaaatcc 120 attggccccg agctagtaaa acagaatttc gatgttaccc agcaggaaga aatcgatgat 180 tttatgatta acctagatgg caccgaaaat aaatcgaaat ttggagccaa cgccatttta 240 ggggtgtcgc ttgctgtgtg taaagccggt gcggcaaaac gaggccttcc cttgtatcga 300 cacatagctg atttagccgg taataaaaac attatcctcc ccgtcccggc tttcaacgtc 360 attaatggag gctcgcatgc tggaaataaa ctggcgatgc aagaattcat gatccttcca 420 accggagcat gctcgtttac ggaagccatg aagatgggct gcgaaactta ccataaccta 480 aagaaaatta tcaaagataa atacggcctt gacgccaccg cagtgggcga tgaaggtggg 540 ttcgccccaa atatcacaaa taacaaggat gcccttcaaa tcatcaacga tgccattgcc 600 // ID LN889216; SV 1; linear; genomic DNA; STD; INV; 435 BP. XX AC LN889216; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Demimaea cf. strumosa MB-2015 partial Enolase gene for Enolase, isolate DE ARC3502 XX KW . XX OS Demimaea cf. strumosa MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Tychiini; Demimaea. XX RN [1] RP 1-435 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2d0a9714a23dcf3530ed6dff0d1d6697. XX FH Key Location/Qualifiers FH FT source 1..435 FT /organism="Demimaea cf. strumosa MB-2015" FT /isolate="ARC3502" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738345" FT CDS <1..>435 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZT4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZT4" FT /protein_id="CUR50047.1" FT /translation="EEIDDFMIKLXGTDXKSXFGANAJXGVSLAVCKAGAAKRGVPLYR FT XIADLCGNKNLVLPVPAFNVINGGSHAGNKLXMQEFLILPTGANTFTEAMXMGSETYHN FT LKKIIKDKXGLDATAVXDEXGFXPNITNNKDALQIINDAIS" XX SQ Sequence 435 BP; 131 A; 91 C; 89 G; 108 T; 16 other; gaggaaattg atgattttat gattaaatta sakggaaccg acmacaaatc taawtttgga 60 gccaaygcam ttstgggtgt gtcccttgcc gtatgcaaag ctggtgctgc aaaacgtggg 120 gtgcccttgt atcggcwcat agctgattta tgtggaaaca aaaatcttgt tcttccggtc 180 ccggctttta atgtcataaa tggaggctcc cacgcaggaa acaaactakc catgcaggaa 240 ttccttattc ttcctactgg agcaaacact ttcactgaag ccatgaasat gggtagcgag 300 acataccaca acctsaagaa aattatcaaa gacaagtrcg ggcttgatgc cactgcwgtg 360 gragatgaak gaggcttcrc acctaatata accaacaata aagacgctct tcaaattatt 420 aatgacgcca tctct 435 // ID LN889217; SV 1; linear; genomic DNA; STD; INV; 429 BP. XX AC LN889217; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Storeus sp. ARC3515 partial Enolase gene for Enolase, isolate ARC3515 XX KW . XX OS Storeus sp. ARC3515 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Storeus; unclassified Storeus. XX RN [1] RP 1-429 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 00a15e89e8c6bb7934584aecb394ec93. XX FH Key Location/Qualifiers FH FT source 1..429 FT /organism="Storeus sp. ARC3515" FT /isolate="ARC3515" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736951" FT CDS <1..>429 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L163" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L163" FT /protein_id="CUR50048.1" FT /translation="IDDFMIXLXGTDNXSNFXANAILGVSLAVCKAGAAKRGIXLYRHI FT XXLXGNKNIILPVPXFNVINGGDHAGNKLAMQEFMILPTGACSFTEAMXMGSETYHNLS FT KIIKDKYGLXATAVXDEGGFAPNINNNKEALQILNDAIA" XX SQ Sequence 429 BP; 134 A; 78 C; 88 G; 116 T; 13 other; atcgacgatt ttatgatcaa wctggakggg actgacaata astccaattt tgsagctaat 60 gctattttgg gagtgtcctt ggcagtttgt aaagctggtg ctgctaaaag gggaattcyt 120 ttataccgcc acattgmasa cctagsagga aacaagaata taattctacc tgtwccarcg 180 ttcaatgtca ttaatggcgg agatcatgcc ggtaacaaac tagcgatgca agaatttatg 240 attttaccaa ctggtgcatg ttcttttact gaagctatga asatgggctc ggaaacttac 300 cataacctgt ccaagatcat taaggataaa tatggattgs atgctacagc agtcrgagat 360 gaaggtggat ttgctccaaa cataaataac aataaagaag ctcttcagat cttaaacgac 420 gccatcgcc 429 // ID LN889218; SV 1; linear; genomic DNA; STD; INV; 591 BP. XX AC LN889218; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Kyklioacalles roboris partial Enolase gene for Enolase, isolate ARC3531 XX KW . XX OS Kyklioacalles roboris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Kyklioacalles. XX RN [1] RP 1-591 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 088bf6130e6eb134c601f43b8ef285f3. XX FH Key Location/Qualifiers FH FT source 1..591 FT /organism="Kyklioacalles roboris" FT /isolate="ARC3531" FT /mol_type="genomic DNA" FT /db_xref="taxon:501664" FT CDS <1..>591 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYB6" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYB6" FT /protein_id="CUR50049.1" FT /translation="PLGASTGIHEALELRDDIPEDYLGKGVGKAVDNVNKSIGPEVVKQ FT NFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAICKAGAAKRGLPLYRHIADLAG FT NKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGAETYHNLKKIIKD FT KYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 591 BP; 181 A; 132 C; 141 G; 137 T; 0 other; cccctcggtg ccagtacagg tatccacgaa gccttagaac tcagagacga tatccctgaa 60 gactatttag ggaaaggagt tggtaaggcg gtagacaatg tgaataaatc catcggtccc 120 gaggtggtga aacaaaactt cgatgtcact cagcaggagg aaatcgacga cttcatgatt 180 aagttggatg gtaccgaaaa taagtcgaat ttcggggcca atgcaatttt aggagtatcc 240 ttggcaatat gtaaagcggg tgccgccaaa cgaggattac ctttgtatcg ccatatagcc 300 gacttagctg gaaacaagaa catcatcctt cctgtcccag cctttaacgt tattaatgga 360 ggttcacacg ctggcaataa actagcgatg caggaattca tgatccttcc tactggagcc 420 tgctctttca ctgaagccat gaagatgggt gctgaaacct accataacct gaagaaaatc 480 attaaagaca agtatggact ggacgccact gcggtgggag acgaaggggg gtttgcacca 540 aatatcacca acaataaaga cgctcttcta atcatcaacg acgctattgc t 591 // ID LN889219; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889219; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Trigonopterus cf. squamosus MB-2015 partial Enolase gene for Enolase, DE isolate ARC3664 XX KW . XX OS Trigonopterus cf. squamosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Trigonopterus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7c715a442d201d021693fded10f49734. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Trigonopterus cf. squamosus MB-2015" FT /isolate="ARC3664" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738369" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L5M3" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5M3" FT /protein_id="CUR50050.1" FT /translation="AAVPSGASTGIHEALELRDEIPEDYVGKGVFKAVNHVNNQIGPEL FT VKQNLNVTQQEEIDEFMLXLDGTENKSNFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIVLPVPAFNVINGGSHAGNKLAMQEFMLLPTGANSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 192 A; 131 C; 142 G; 130 T; 5 other; gccgcggtcc cgtcaggtgc cagtaccggt attcacgaag ccctagaact cagagacgag 60 atccctgaag actatgtagg taaaggagtc tttaaagcgg taaatcacgt gaataatcag 120 attgggcccg agttagtaaa acaaaatttg aatgttacgc aacaggagga aatcgatgag 180 tttatgctcm aacttgatgg cacggagaat aaatcgaatt ttggggcsaa ygckatytta 240 ggagtatcgc tggccgtatg caaagctggt gcggccaaac gaggagtgcc cctctatcga 300 catatagctg atttagccgg aaataaaaac atcgtccttc ccgtaccggc tttcaatgtc 360 attaatggag gctcacatgc cggaaacaag ctggctatgc aagaattcat gcttcttcca 420 accggcgcaa actcttttac ggaagctatg aagatgggaa gcgaaaccta tcacaatttg 480 aagaaaataa tcaaagacaa gtatggcctt gacgcaactg cagtaggaga cgaaggcggg 540 ttcgcaccaa acatcacaaa taacaaagac gcccttcaaa tcatcaatga tgccatagct 600 // ID LN889220; SV 1; linear; genomic DNA; STD; INV; 564 BP. XX AC LN889220; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neodecilaus picus partial Enolase gene for Enolase, isolate ARC3780 XX KW . XX OS Neodecilaus picus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Neodecilaus. XX RN [1] RP 1-564 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 56d29a053d5c45297861d667d8531df2. XX FH Key Location/Qualifiers FH FT source 1..564 FT /organism="Neodecilaus picus" FT /isolate="ARC3780" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738257" FT CDS <1..>564 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYJ9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYJ9" FT /protein_id="CUR50051.1" FT /translation="EAXELXDENPQDFLGKGVTKAVDHVNKSIGPELVKQNFDVTQQEE FT IDDFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKHLILPVP FT AFNVINGGSHAGNKLAMQEFMLLPTGASSFSEAMKMGAETYHNLKKIIKDKYGLDATAV FT GDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 564 BP; 175 A; 131 C; 127 G; 129 T; 2 other; gaagcccwgg aactgakaga cgagaatcct caagattttc taggtaaagg agtaactaaa 60 gctgtagacc acgtgaacaa atccatcggt cccgaattgg taaaacaaaa tttcgatgtt 120 actcaacaag aggaaatcga cgattttatg attaaactcg atggtacaga gaataaatcc 180 aaatttgggg cgaacgccat tttgggcgtc tcgctcgccg tatgcaaagc cggtgctgcc 240 aaacgaggag tacccttgta cagacatata gctgacctag ctggaaacaa acacctaatt 300 cttcctgtcc ctgcttttaa cgtcatcaat ggaggttcgc atgccggaaa caagctggcc 360 atgcaagagt tcatgctcct tccaactggg gcgtcctcgt tctctgaagc catgaagatg 420 ggcgccgaaa cttaccacaa cctgaagaaa atcattaaag acaagtacgg tcttgacgcg 480 accgcagtgg gagatgaagg cggtttcgct ccaaatatta caaataataa agacgccctt 540 ttgatcatta acgatgccat tgca 564 // ID LN889221; SV 1; linear; genomic DNA; STD; INV; 546 BP. XX AC LN889221; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Hypsophorus dromedarius partial Enolase gene for Enolase, isolate ARC3786 XX KW . XX OS Hypsophorus dromedarius OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Hypsophorus. XX RN [1] RP 1-546 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6180a339aa52b3d2d7dc351a9bc3f1dd. XX FH Key Location/Qualifiers FH FT source 1..546 FT /organism="Hypsophorus dromedarius" FT /isolate="ARC3786" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738294" FT CDS <1..>546 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3U8" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3U8" FT /protein_id="CUR50052.1" FT /translation="DEIPEXYXGXXVSKAXENVNTAIGPXLVKQNFDVTQXEEIDXFMI FT KLDGTXNXSKFGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKNIXLPVPAFNVIN FT GGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKIIKDKYGLDATAVGDEGGF FT APNITNNKDALQIINDAIA" XX SQ Sequence 546 BP; 171 A; 118 C; 122 G; 120 T; 15 other; gacgagatcc cggaaaasta tcytggtraa kgagtgagca aagccrtgga aaatgtgaat 60 acrgccatcg gcccckagtt ggtgaaacaa aatttcgatg taacccaacw wgaggaaatc 120 gatragttta tgattaaact agatggcacc gakaataast cgaaatttgg agccaatgct 180 attttgggtg tctcgcttgc ggtatgcaaa gccggagctg ctaagcgagg tgtaccgctc 240 tatcgacata tagctgattt agcaggaaac aaaaacatcr tccttcctgt tcctgccttc 300 aacgtaatca acggaggttc gcatgcaggt aacaaattag cgatgcagga gttyatgatt 360 cttccaaccg gcgcatgttc gtttaccgaa gccatgaaga tgggcagtga aacttaccat 420 aacctgaaga aaatcatcaa agacaaatac ggtcttgacg ctacygctgt aggagacgag 480 ggcggtttcg caccaaacat caccaataac aaagatgccc ttcaaataat caacgatgca 540 atcgcc 546 // ID LN889222; SV 1; linear; genomic DNA; STD; INV; 576 BP. XX AC LN889222; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus sphacelatus partial Enolase gene for Enolase, isolate ARC3791 XX KW . XX OS Poropterus sphacelatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. XX RN [1] RP 1-576 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 921611fc33537d371cbafbec77baa1d1. XX FH Key Location/Qualifiers FH FT source 1..576 FT /organism="Poropterus sphacelatus" FT /isolate="ARC3791" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738277" FT CDS <1..>576 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZ64" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ64" FT /protein_id="CUR50053.1" FT /translation="TGIHEALELXDEIPEDYLGKGVSKAVDHVNKXIGPELVKQNFDVT FT QQEXIDDFMXKLDGTENKSKFGAXAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKXLI FT LPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKIIKDKYGLD FT ATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 576 BP; 177 A; 126 C; 135 G; 128 T; 10 other; acaggtattc acgaagcctt ggagctcasa gacgaaattc ccgaagacta cttgggcaaa 60 ggagtcagca aagcggtaga ccatgtgaat aaakcgatcg gkcccgagtt ggtgaaacaa 120 aatttcgacg tcacccagca ggaggrgatt gatgatttta tgatsaagct agacggtacs 180 gagaataaat craagttcgg agccartgcc attttgggag tttcgctcgc tgtatgcaaa 240 gccggtgcgg ccaaacgagg cgtgccccta tatcgacata tagctgattt agccggaaat 300 aaaartctca tcctacccgt cccrgctttc aatgtcatta atggcggttc acatgctgga 360 aacaagctgg cgatgcaaga attcatgatt cttccgactg gagcgtgctc tttcaccgag 420 gccatgaaga tgggctctga aacttaccac aacctgaaaa aaattatcaa agacaagtat 480 ggccttgatg ctactgcagt gggtgatgaa ggaggattcg caccaaacat aacaaataat 540 aaagatgccc ttcaaataat caacgatgct atcgca 576 // ID LN889223; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889223; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Genuacalles sp. ARC3823 partial Enolase gene for Enolase, isolate ARC3823 XX KW . XX OS Genuacalles sp. ARC3823 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Genuacalles; unclassified Genuacalles. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4076d49381f63d04bbcb85aae5207ce2. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Genuacalles sp. ARC3823" FT /isolate="ARC3823" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736970" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3C7" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3C7" FT /protein_id="CUR50054.1" FT /translation="AAVPSGASTGIHEALELRDDNPKDYVGKGVSKAVNNVNNSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTENKANFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 186 A; 139 C; 145 G; 130 T; 0 other; gccgccgtcc cgtcaggtgc tagtacaggt attcacgaag cgctagaact cagagatgac 60 aatccgaaag actacgtggg aaaaggagtg agtaaagctg ttaacaacgt aaacaattcc 120 attggacccg aattagttaa acagaacttc gatgttaccc aacaggagga aatcgatgac 180 tttatgatta agcttgatgg cacggagaat aaagcgaatt tcggggccaa tgccattcta 240 ggggtatcgc ttgccgtatg caaagccggt gcggctaaac ggggattgcc actctatcga 300 catattgccg atttagccgg aaataaaaat attattcttc cagtccccgc tttcaacgtc 360 ataaatggag gttcgcatgc cggaaacaag ctggcaatgc aggaattcat gattcttcca 420 actggggcga actcctttac ggaggccatg aagatgggct cggaaactta ccacaatctg 480 aagaaaatca tcaaagacaa gtacggcctc gacgccaccg cagtgggaga tgaaggtggg 540 ttcgctccaa acatcacgaa taacaaagac gctcttctaa taatcaacga cgctatcgcc 600 // ID LN889224; SV 1; linear; genomic DNA; STD; INV; 591 BP. XX AC LN889224; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Decilaus sp. ARC3830 partial Enolase gene for Enolase, isolate ARC3830 XX KW . XX OS Decilaus sp. ARC3830 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Decilaus; unclassified Decilaus. XX RN [1] RP 1-591 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e5f744ea24e4e5f9a408acf2d4f0c8cd. XX FH Key Location/Qualifiers FH FT source 1..591 FT /organism="Decilaus sp. ARC3830" FT /isolate="ARC3830" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736924" FT CDS <1..>591 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYP9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYP9" FT /protein_id="CUR50055.1" FT /translation="PSGASTGIHEALELRDEIKEDYLGKGVFKAIDNVNKSLGPELVKQ FT NFDVTQQEEIDEFMIKLDGTENKSKFGANAILGVSLAICKAGAAKRGVPLYRHIADLAG FT NKNIVLPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFTEAMKMGAETYHQLKKIIKD FT KYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 591 BP; 193 A; 120 C; 135 G; 140 T; 3 other; ccgtcaggtg ccagtacagg tatccacgaa gccttagaac tgagagatga gattaaagaa 60 gactacttag gtaaaggagt ctttaaagcg atagataatg tgaataaatc cctcggtcct 120 gaattggtaa aacagaattt cgaygttact caacaggagg aaatcgatga gtttatgatt 180 aaattagayg gcacagagaa taaatcgaaa ttcggcgcca atgccatttt aggagtatct 240 cttgccatwt gcaaagccgg tgctgccaaa cgaggagtgc ccttatatcg acatatagct 300 gatttggccg gaaataaaaa tatcgttctt cccgttccgg ctttcaacgt cattaatgga 360 ggatcgcacg ctggaaacaa gttggcgatg caagaattca tgattcttcc cactggagca 420 aattctttta cggaagccat gaagatgggt gccgaaactt accaccagct gaagaaaatt 480 atcaaagaca aatatggcct ggacgccact gcagtgggag acgaaggcgg gttcgcacca 540 aacatcacaa ataacaaaga tgctcttcta atcatcaatg atgccattgc a 591 // ID LN889225; SV 1; linear; genomic DNA; STD; INV; 564 BP. XX AC LN889225; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neomystocis squamiventris partial Enolase gene for Enolase, isolate ARC3849 XX KW . XX OS Neomystocis squamiventris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Neomystocis. XX RN [1] RP 1-564 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7fe7c91a84d064316f2582d052c8ba7d. XX FH Key Location/Qualifiers FH FT source 1..564 FT /organism="Neomystocis squamiventris" FT /isolate="ARC3849" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738259" FT CDS <1..>564 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1L9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1L9" FT /protein_id="CUR50056.1" FT /translation="EALELRDEIPEBYMGKGVSKAVDHVNKSIGPELVKQNFDVTQQEE FT IDDFMIKLDGTDNKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKNIILPVP FT AFNVINGGSHAGNKLAMQEFMILPTGACSFTQAMKMGAETYHNLKKIIKDKYGLDATAV FT GDEGGFAPNITNNKDALQIINDAIS" XX SQ Sequence 564 BP; 183 A; 128 C; 131 G; 121 T; 1 other; gaagccctag aacttcgaga tgagattccg gaaractata tgggcaaggg agtcagcaaa 60 gccgtagacc acgtaaataa atccattggc ccggagttgg taaaacagaa tttcgatgtc 120 acccagcagg aagaaatcga cgattttatg attaaactag acggcaccga taataaatcc 180 aagttcgggg ccaatgccat tttaggagta tcgcttgctg tatgtaaagc cggcgcggca 240 aaacgaggag tgccactgta ccgacatata gccgatttag ccggaaataa aaatatcatc 300 cttcccgttc ccgccttcaa cgtcattaat ggaggttcac acgcgggaaa taaactagcg 360 atgcaagaat tcatgatcct tccgactgga gcctgttcgt ttacacaagc aatgaagatg 420 ggtgccgaaa cttaccacaa tctaaagaaa attatcaagg acaagtatgg cctggacgcc 480 actgcagtgg gagatgaagg tgggtttgca ccaaacataa ccaataacaa agacgctctg 540 cagattatca atgacgccat ctcc 564 // ID LN889226; SV 1; linear; genomic DNA; STD; INV; 597 BP. XX AC LN889226; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Melanterius aratus partial Enolase gene for Enolase, isolate ARC3853 XX KW . XX OS Melanterius aratus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Melanterius. XX RN [1] RP 1-597 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5e271b902d85e8d25126247eadb58127. XX FH Key Location/Qualifiers FH FT source 1..597 FT /organism="Melanterius aratus" FT /isolate="ARC3853" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738316" FT CDS <1..>597 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L130" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L130" FT /protein_id="CUR50057.1" FT /translation="AVPSGASTGVXEALELRDNIPEQXJXXGVGKAVENVNNSIGPELV FT XQDFDVTQQEEIDEFMIKLDGTDNKSKFGANAILGVSXAVCKAGAAKRGVPLYRHIADL FT AGNXNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKII FT KDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIS" XX SQ Sequence 597 BP; 175 A; 131 C; 141 G; 142 T; 8 other; gcagttcctt ctggagcaag tacaggtgtg cawgaggctt tggaactccg agataacatc 60 ccggagcagw acmtargtra aggtgtgggc aaggctgtgg aaaatgtgaa caattccatt 120 ggccccgagt tggttgscca agattttgac gtgacccaac aagaggaaat tgacgaattt 180 atgattaaac tcgatgggac tgataacaaa tcgaaattcg gtgcgaacgc cattttgggt 240 gtttccstag ctgtgtgcaa agctggcgct gctaagagag gtgtgccttt gtaccgacat 300 atagctgacc tagctggaaa cragaatata atccttcccg ttcccgcttt caacgtcatt 360 aacggaggct ctcatgcagg taacaaacta gcaatgcaag aatttatgat ccttcctact 420 ggagcgtgct ccttcaccga agccatgaag atgggaagtg aaacttacca caaccttaaa 480 aaaatcatca aagacaaata tggactcgac gctactgctg tgggtgacga aggaggtttt 540 gctccgaaca tcacaaacaa taaggacgcc cttcaaatta tcaacgatgc catctct 597 // ID LN889227; SV 1; linear; genomic DNA; STD; INV; 144 BP. XX AC LN889227; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acrotychreus fasciculatus partial Enolase gene for Enolase, isolate ARC3865 XX KW . XX OS Acrotychreus fasciculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acrotychreus. XX RN [1] RP 1-144 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ddf0a04103b1f5ee67a3619219454cda. XX FH Key Location/Qualifiers FH FT source 1..144 FT /organism="Acrotychreus fasciculatus" FT /isolate="ARC3865" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738220" FT CDS <1..>144 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L177" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L177" FT /protein_id="CUR50058.1" FT /translation="GTETYHNLKKIIKDKYGLDATAVGDEGGFAPNITNNKDALLIIND FT AIA" XX SQ Sequence 144 BP; 50 A; 38 C; 29 G; 27 T; 0 other; ggtaccgaaa cttaccataa tctgaagaaa atcatcaaag acaagtacgg cctcgacgcc 60 actgcagtgg gcgatgaagg tgggttcgca ccaaacatca caaacaacaa agacgctctt 120 ctaatcatca atgatgccat tgcc 144 // ID LN889228; SV 1; linear; genomic DNA; STD; INV; 522 BP. XX AC LN889228; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3869 partial Enolase gene for Enolase, isolate DE ARC3869 XX KW . XX OS Cryptorhynchini gen. sp. ARC3869 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-522 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 00715794447aaf88b383da6b0277b2d6. XX FH Key Location/Qualifiers FH FT source 1..522 FT /organism="Cryptorhynchini gen. sp. ARC3869" FT /isolate="ARC3869" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742680" FT CDS <1..>522 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3L2" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3L2" FT /protein_id="CUR50059.1" FT /translation="GKGVSKAVNNVNKXIGPELXKQNFDVTQQEEIDBFMIKLDGTXNK FT SNFGANAIXGVSLAVCXAGAAKRGLPLYRHIADLAGNKNIILPVPAFNVINGGSHAGNK FT LAMQEFMILPTGATSFTQAMKMGSETYHNLKKIIKDKYGLDATAVGDEGGFAPNITNNK FT DALLIINDAIA" XX SQ Sequence 522 BP; 154 A; 128 C; 129 G; 104 T; 7 other; ggcaaagggg tcagtaaggc ggtaaacaac gtaaataaat kcatcggtcc tgaattaktg 60 aaacaraatt tcgatgtcac ccaacaggaa gaaatcgacr attttatgat caagctagac 120 ggcaccraga ataaatcgaa ttttggggcc aacgccattt kgggggtgtc gctggccgta 180 tgcaragcgg gcgcggccaa gcgggggctc cccttgtacc gacatatagc cgatctggca 240 ggaaataaaa atattattct ccccgtgccg gctttcaacg tcatcaatgg cggttcgcat 300 gccgggaaca agctggcgat gcaagaattc atgatccttc cgactggagc gacctctttt 360 acgcaagcca tgaagatggg cagcgaaacc taccacaacc tgaagaaaat catcaaagac 420 aagtacggtc ttgacgccac tgcagttgga gacgaaggcg ggttcgcgcc gaacatcaca 480 aataacaaag acgccctttt gatcattaac gatgccatcg cc 522 // ID LN889229; SV 1; linear; genomic DNA; STD; INV; 597 BP. XX AC LN889229; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Echinodera hypocrita partial Enolase gene for Enolase, isolate ARC3900 XX KW . XX OS Echinodera hypocrita OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Echinodera; Ruteria. XX RN [1] RP 1-597 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 37863fcb40431bef84172ca7d33069fd. XX FH Key Location/Qualifiers FH FT source 1..597 FT /organism="Echinodera hypocrita" FT /isolate="ARC3900" FT /mol_type="genomic DNA" FT /db_xref="taxon:501686" FT CDS <1..>597 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYK9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYK9" FT /protein_id="CUR50060.1" FT /translation="AVPSGASTGVHEALELRDEIPEDYMGKGVCKAVDHVNKCIGPELV FT KQNFDVTQQEEIDDFMIQLDGTENKSKFGANAILGVSLAICKAGAAKRGLPLYRHIADL FT AGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFSEAMKMGSETYHNLKKII FT KDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 597 BP; 182 A; 127 C; 146 G; 142 T; 0 other; gcagttccat caggtgcgag tacaggtgtt catgaagctt tagaactcag agatgaaatc 60 ccagaagact acatgggaaa gggggtgtgt aaagcagtag accatgtcaa taaatgtatt 120 ggacccgagt tggtgaaaca aaatttcgat gtcacgcaac aagaagaaat cgacgacttt 180 atgattcagc tggatggcac cgagaacaag tcgaagtttg gtgccaatgc tattttagga 240 gtgtccctcg ccatatgcaa agctggtgct gctaaacgag gactgccttt gtacaggcat 300 atagctgatt tagccggtaa taagaatatc atcctacctg taccggcttt caacgtcatt 360 aatgggggtt cgcatgccgg aaacaaactg gcgatgcaag agttcatgat ccttccaaca 420 ggagcttgtt ctttttccga agccatgaag atgggctctg aaacttacca taacctgaag 480 aaaattatca aggacaaata cggacttgat gccaccgcag tgggagatga aggtgggttc 540 gcaccaaata tcactaacaa caaggacgct cttctgatca ttaacgacgc catcgcc 597 // ID LN889230; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889230; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles lemur partial Enolase gene for Enolase, isolate ARC3902 XX KW . XX OS Acalles lemur OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e8ef24a9ee834311b50afebbf8e48301. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Acalles lemur" FT /isolate="ARC3902" FT /mol_type="genomic DNA" FT /db_xref="taxon:501598" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L175" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L175" FT /protein_id="CUR50061.1" FT /translation="AAVPSGASTGIHEALELRDEIPEDYMGKGVSKAVEHVNKCIGPEL FT VKQNFCVTQQEEIDEFMIKLDGTENKSNFGANAILGVSLAVCKAGAARRGIPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFTEAMKMGAETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 192 A; 131 C; 143 G; 134 T; 0 other; gcagcagttc catcaggtgc cagtacaggt attcatgaag ctctagaact tagagatgaa 60 atccctgaag actatatggg aaaaggggtt agtaaagcgg tagaacacgt caacaaatgc 120 atcgggcctg agttggtgaa acaaaatttc tgcgtcaccc aacaagagga aatcgacgaa 180 tttatgatca agctggatgg gactgaaaac aaatcgaatt ttggcgccaa tgccattcta 240 ggagtgtccc ttgccgtatg taaagctggt gctgccagac gaggaatacc tttgtacagg 300 cacatagctg atttagctgg aaacaagaat ctcatcctac cggtaccagc ttttaatgtc 360 atcaatggag gctcgcatgc cggaaacaaa ttggcgatgc aagagttcat gattcttcct 420 actggagcga actcttttac cgaggctatg aagatgggcg ccgaaacgta tcataaccta 480 aagaaaatta taaaagacaa gtacggattg gacgccactg ccgtgggcga tgaaggcggc 540 ttcgcaccaa acatcaccaa taacaaagac gcacttcaaa tcatcaacga cgctattgct 600 // ID LN889231; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889231; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Anthonomus rectirostris partial Enolase gene for Enolase, isolate ARC3905 XX KW . XX OS Anthonomus rectirostris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Anthonomini; Anthonomus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 41b910feabb8e098936971b2c32c0042. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Anthonomus rectirostris" FT /isolate="ARC3905" FT /mol_type="genomic DNA" FT /db_xref="taxon:1341944" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1E3" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1E3" FT /protein_id="CUR50062.1" FT /translation="AAVPSGASTGVHEALELRDEVPQDYCGKGVSKAVDHVNNTIGPEL FT VKQDFCVTQQEEIDDFMINLDGTDNKSKFGANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKILILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSEVYHNLKKI FT IKDKYGLDATAVGDEGGFAPNIANNKDALQIINDAIA" XX SQ Sequence 600 BP; 196 A; 104 C; 137 G; 162 T; 1 other; gcggcagtac cttctggagc gagcactggt gttcacgagg cgctggaact tcgtgatgaa 60 gttccccaag actactgtgg taaaggtgta tcgaaggcag tcgaccatgt taataacact 120 atcggaccag aactagtcaa gcaagatttt tgtgtaactc aacaagaaga aattgatgac 180 ttcatgatta accttgatgg tactgacaac aagtctaagt ttggtgcaaa tgctatacta 240 ggagtttcct tagctgtatg taaagcagga gcagcaaaac gagggttacc attatataga 300 catatagctg atttagcagg gaataagata cttatactac cagtgcctgc atttaatgtg 360 atcaatggtg gttctcatgc tggaaacaaa ctagcaatgc aagaatttat gatacttcct 420 acaggggcat gctcttttac tgaagcaatg aaaatgggtt ccgaagtgta ccataattta 480 aaaaaaatta ttaaggataa atatggcttg gatgctacag cagtcgggga ygaaggaggg 540 tttgctccta atatagcaaa taacaaagat gctttacaaa ttattaatga tgccatcgcc 600 // ID LN889232; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889232; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Curculio glandium partial Enolase gene for Enolase, isolate ARC3907 XX KW . XX OS Curculio glandium OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Curculionini; Curculio. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a5685e185aaf3cfb447d1e345fd230e3. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Curculio glandium" FT /isolate="ARC3907" FT /mol_type="genomic DNA" FT /db_xref="taxon:197013" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZU6" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZU6" FT /protein_id="CUR50063.1" FT /translation="AAVPSGASTGVHEALELRDEIKEDYMGKGVFKAVGHVNNSIGPEL FT VKQDFDVTQQEEIDEFMIKLDGTENKSNFGANAILGVSLAICKAGAAKRGIPLYRHIAD FT LAGNKNIVLPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINEAIS" XX SQ Sequence 600 BP; 190 A; 118 C; 132 G; 146 T; 14 other; gctgcagtcc cgtcaggggc cagtacaggt gttcatgaag ctttggaact cagagatgaa 60 attaaggaag actatatggg caaaggagtt tttaaagccg taggccacgt aaacaattcg 120 attggtcccg agctagttaa gcaagatttt gatgttactc aacaagaaga aatcgatgag 180 tttatgatta agctcgatgg aacggaaaat aartcaaatt ttggtgccaa tgcaattttg 240 ggagtmtctc ttgccatatg caaagctggt gctgcaaaaa gaggtattcc tttgtatcgc 300 cacatcgcag atctagcagg aaacaagaat atygtrctkc cagttccagc ttttaaygtc 360 atcaatggag gytcccatgc tggtaataag ctagcgatgc aagaatttat gattctyccc 420 acwggkgcaa attcgttcac tgaagcmatg aaaatgggca gcgaaaccta ccataacctc 480 aaaaaaatca tcaaagataa atacggrctt gacgctactg ctgttggaga cgaaggwggt 540 tttgcyccaa acatcaccaa taataaagac gctcttcaga taatcaacga ggccatctcc 600 // ID LN889233; SV 1; linear; genomic DNA; STD; INV; 594 BP. XX AC LN889233; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Magdalis ruficornis partial Enolase gene for Enolase, isolate ARC3908 XX KW . XX OS Magdalis ruficornis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Magdalinae; Magdalis. XX RN [1] RP 1-594 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e5fa6477570db4cd7396d8344c80f160. XX FH Key Location/Qualifiers FH FT source 1..594 FT /organism="Magdalis ruficornis" FT /isolate="ARC3908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1342046" FT CDS <1..>594 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L183" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L183" FT /protein_id="CUR50064.1" FT /translation="AAVPSGASTGVHEALELRDNIPEDYLGKGVNKAVENVNNSIGPEL FT VKQEFDVTQQEEIDEFMINLDGTENKSKFGANAILGISLAVCKAGAAKRGLPLYRHVAD FT LAGNKQLIMPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFAEAMKMGSEVYHNLKKI FT IKDKYGLDATAVGDEGGFAPNIANNKDALQIINDA" XX SQ Sequence 594 BP; 187 A; 125 C; 141 G; 138 T; 3 other; gcagccgttc cgtcaggtgc gagtacagga gtgcacgagg ctttggaact cagagataat 60 attccrgaag actatttagg taaaggagtt aataaagctg tggaaaacgt aaacaactcc 120 atcggtcccg agttggtaaa acaagagttt gatgtgactc aacaggagga aatagacgag 180 ttcatgatta atctagatgg aaccgaaaat aaatccaagt ttggcgccaa tgctattttg 240 ggaatatcac ttgccgtttg taaagcaggt gccgcraaaa ggggcttgcc cttatatcgc 300 cacgtagctg atytagctgg taataaacag ctgatcatgc ctgtgccagc tttcaacgtt 360 attaacggag gatcccatgc cggcaataaa ctggcaatgc aggaattcat gattcttcca 420 accggagcgt gctctttcgc tgaagctatg aaaatgggaa gcgaagttta ccataaccta 480 aaaaaaatta tcaaagacaa atacggcctt gacgctaccg ctgtgggaga tgaaggcggt 540 ttcgcgccaa acatcgccaa caacaaagac gctcttcaaa ttatcaatga cgcc 594 // ID LN889234; SV 1; linear; genomic DNA; STD; INV; 575 BP. XX AC LN889234; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nedyus quadrimaculatus partial Enolase gene for Enolase, isolate ARC3910 XX KW . XX OS Nedyus quadrimaculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Ceutorhynchinae; Nedyus. XX RN [1] RP 1-575 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5aeaa98373fc11635c90844183f8ef00. XX FH Key Location/Qualifiers FH FT source 1..575 FT /organism="Nedyus quadrimaculatus" FT /isolate="ARC3910" FT /mol_type="genomic DNA" FT /db_xref="taxon:202049" FT CDS <1..>575 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYD1" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYD1" FT /protein_id="CUR50065.1" FT /translation="AAVPSGASTGVHEALELRDDVKDEYMGKGVAKAVGHIKNTIGPAL FT VKQNFDVTQQEAIDDFMIKLDGTDNKSQFGANAILGVSLAICKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGAYSFAEAMRMGSETYHHLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDA" XX SQ Sequence 575 BP; 174 A; 123 C; 133 G; 145 T; 0 other; gcggcggtac catcgggtgc cagtaccgga gtccacgaag cattagaact tcgggacgat 60 gtcaaagacg agtatatggg aaaaggcgtt gccaaagccg tgggtcatat taagaacacc 120 atcggccctg cattggtaaa acaaaatttt gatgtcactc agcaagaagc tattgacgat 180 tttatgataa agcttgatgg tactgataat aaatcgcaat ttggtgccaa tgccatattg 240 ggagtttctt tggcaatatg taaagctgga gctgccaaac gtggattacc tttgtatagg 300 catattgccg atttggctgg gaataaaaat atcattcttc ctgtaccagc attcaacgtc 360 atcaatggtg gttctcacgc tggcaacaaa ctggcaatgc aagaattcat gatcctcccc 420 actggtgcct actcgtttgc cgaagctatg agaatgggca gtgaaactta tcaccacctc 480 aaaaaaatca tcaaagacaa atatggtttg gatgctaccg ctgtaggcga tgaaggaggc 540 tttgccccaa atatcaccaa taacaaagac gcctt 575 // ID LN889235; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889235; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinoncus castor partial Enolase gene for Enolase, isolate ARC3921 XX KW . XX OS Rhinoncus castor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Ceutorhynchinae; Rhinoncus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 20c20287d12698a6bbc5703bbd85acce. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Rhinoncus castor" FT /isolate="ARC3921" FT /mol_type="genomic DNA" FT /db_xref="taxon:878412" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L5P1" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5P1" FT /protein_id="CUR50066.1" FT /translation="AAVPSGASTGVHEALELRDDIKDEYMGKGVSKAVTHIKNTIGPAL FT VKQNFDVTQQEEIDDFMIKLDGTDNKSQFGANAILGVSLAICKAGAAKRGLPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMIFPTGAHSFTEAMRMGSETYHHLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINEAIS" XX SQ Sequence 600 BP; 200 A; 109 C; 124 G; 167 T; 0 other; gccgcagtac cgtcaggtgc aagtactgga gtccacgaag ctttggaact ccgcgatgac 60 atcaaagacg agtatatggg aaaaggcgta agcaaagctg ttactcatat taaaaatact 120 atcggtcctg cgctggtaaa gcaaaacttt gacgttactc aacaagaaga aattgatgat 180 tttatgatta agcttgatgg tactgacaat aagtctcaat ttggtgctaa tgcaatactg 240 ggtgtttctt tagcaatatg taaagctggt gctgctaaac gtgggttacc tttgtatagg 300 catattgctg atttagctgg aaataagaat attattcttc cagtaccagc tttcaacgta 360 attaatggtg gttcccacgc aggcaataaa ctagcaatgc aagaattcat gatctttcca 420 actggcgctc attcatttac agaagcaatg agaatgggaa gtgaaactta ccatcacctt 480 aaaaaaatca ttaaagataa atatggttta gatgctactg cagttggaga cgaaggaggt 540 ttcgcaccaa acattaccaa caataaagac gctttacaaa tcattaacga agctatttct 600 // ID LN889236; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889236; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dorytomus longimanus partial Enolase gene for Enolase, isolate ARC3924 XX KW . XX OS Dorytomus longimanus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Brachyceridae; OC Erirhininae; Dorytomus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a1b26d2ad1caebcb5b0644af5a15233d. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Dorytomus longimanus" FT /isolate="ARC3924" FT /mol_type="genomic DNA" FT /db_xref="taxon:201904" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYL8" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYL8" FT /protein_id="CUR50067.1" FT /translation="AAVPSGASTGIHEALELRDNIADQYMGKGVSKAVENVNIHIGPEL FT VKQDFDVTQQEEIDDFMIKLDGTDNKSNFGANALLGVSLAVCKAGAAKRGIPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFTEAMKMGSETYHNLMKS FT IKNKYGLDATAVGDEGGFAPNITNNKDALLIINEAIX" XX SQ Sequence 600 BP; 190 A; 137 C; 138 G; 133 T; 2 other; gctgcagttc catccggcgc cagcaccggc atccacgaag ctctggagct tagagacaat 60 atcgctgatc aatacatggg aaagggcgtt agcaaagctg tggaaaatgt taatattcat 120 attggaccag agctagtgaa acaggatttc gatgtcacgc agcaggagga aatcgacgat 180 tttatgatta aactggatgg aactgacaat aaatcaaact ttggtgccaa tgcactttta 240 ggtgtgtccc tagccgtgtg caaagcaggc gctgccaaac gaggaatacc cttgtaccga 300 cacatagctg acctggcagg aaacaaaaat ataattcttc ccgtgcccgc cttcaacgtt 360 ataaatggcg gatcacatgc aggcaataag ctggcaatgc aagagttcat gattctaccg 420 actggagcaa actcwttcac cgaagctatg aagatgggct ccgagaccta ccacaaccta 480 atgaaaagca tcaaaaataa gtatggattg gatgctaccg ctgttggtga cgaaggaggc 540 ttcgctccga atattaccaa caataaagac gctcttctta tcatcaacga agccataraa 600 // ID LN889237; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889237; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Bothynoderes sp. ARC3928 partial Enolase gene for Enolase, isolate ARC3928 XX KW . XX OS Bothynoderes sp. ARC3928 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Lixinae; Bothynoderes; unclassified Bothynoderes. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cee850492fe9d0488d10dd0ade684db9. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Bothynoderes sp. ARC3928" FT /isolate="ARC3928" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736920" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3W0" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3W0" FT /protein_id="CUR50068.1" FT /translation="AAVPSGASTGIHEALELRDENPDQYMGKGVGKAVENVNNFIGPEL FT VKGDFDVTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAICKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNIGNNKDALEIINNAIN" XX SQ Sequence 600 BP; 210 A; 110 C; 130 G; 147 T; 3 other; gcagctgtcc cgtcaggagc gagtacagga atccatgaag ccttagaact gagagatgaa 60 aatcccgatc aatatatggg aaaaggtgtt ggaaaagctg tggaaaatgt taataatttc 120 atcggcccag aactagtaaa aggagayttc gatgtcactc agcaagagga aatcgatgat 180 ttcatgatta aactggatgg aactgaaaat aagtcaaaat ttggagctaa cgccatatta 240 ggggtctcct tagcaatatg taaagctgga gctgcaaaac gaggagtacc attatatcga 300 cacatagcwg acctagctgg taataaaaat atcatccttc ccgttcccgc attcaacgtt 360 attaatggcg gatctcatgc tggaaacaaa ttagcgatgc aagaattcat gatccttcca 420 actggagcct gttcttttac tgaagctatg aaaatgggca gtgaaactta tcacaatcta 480 aaaaagatca taaaagacaa atacggactt gatgcaactg ctgtgggcga tgaaggtggt 540 ttcgcaccaa atattggtaa taataaagat gcyctcgaaa tcattaacaa tgccattaac 600 // ID LN889238; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889238; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Metoposoma cf. funebris MB-2015 partial Enolase gene for Enolase, isolate DE ARC3956 XX KW . XX OS Metoposoma cf. funebris MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Metoposoma. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d61eac66d95872503ce1f2779ecabe25. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Metoposoma cf. funebris MB-2015" FT /isolate="ARC3956" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738352" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KZ75" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ75" FT /protein_id="CUR50069.1" FT /translation="AAVPSGASTGIHEALELRDNIPDQYMGKGVNKAVENVNLSIGPEL FT VKQSFDVTQQEEIDDFMIKLDGTDNKSNFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHTLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 183 A; 131 C; 136 G; 146 T; 4 other; gcagcagttc cttcaggtgc cagtacaggt atccatgaag ccctcgagct scgagacaat 60 attccagatc agtatatggg caaaggagtt aacaaagctg tagaaaatgt aaacctgtcc 120 atcggccctg agttggtaaa acagagcttc gacgtcactc agcaagagga aattgacgat 180 tttatgatta aactagatgg taccgataat aagtcgaatt ttggggctaa cgccatttta 240 ggagtatctc tagctgtttg taaagctgga gctgccaaac gaggagtgcc tttatatcga 300 catatagcag acctrgcggg aaataaaaac ctcatccttc cggtccccgc tttcaatgtc 360 attaatggtg gctcgcatgc agggaacaaa ctagccatgc aagagtttat gatccttccg 420 actggagcct gttcttttac ggaagcaatg aagatgggca gtgaaactta ccataccctt 480 aaaaaaatca tcaaagataa gtatggattr gacgccaccg crgtaggaga tgaaggcggc 540 tttgcgccca acataactaa caataaagac gcccttctga ttattaacga tgctatcgcc 600 // ID LN889239; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889239; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semnorhynchus sp. ARC3959 partial Enolase gene for Enolase, isolate ARC3959 XX KW . XX OS Semnorhynchus sp. ARC3959 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semnorhynchus; unclassified Semnorhynchus. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0e64310e8d8cc0ad574a29ffc4511434. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Semnorhynchus sp. ARC3959" FT /isolate="ARC3959" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737012" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3E2" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3E2" FT /protein_id="CUR50070.1" FT /translation="AAVPSGASTGIHEALELRDNVPEDYVGKGVSKAVNNVNNSIGPEL FT VKQNFDVTQQEEIDDFMIKLDGTDNKSNFGANAILGVSLAVCKAGAAKRGIPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHNLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIS" XX SQ Sequence 600 BP; 200 A; 114 C; 135 G; 150 T; 1 other; gccgcagttc catcaggtgc tagtacaggt attcacgaag ctytagaact gagagataat 60 gtccctgaag actatgtggg aaaaggtgtc agtaaagcag tgaacaatgt caataattct 120 attggtcctg agttagtgaa acaaaatttt gatgtcaccc agcaagaaga aatcgacgat 180 ttcatgatta aactagacgg taccgataat aagtcgaatt ttggggccaa tgcaattctt 240 ggcgtgtctc ttgccgtatg caaggctgga gcagccaaaa gaggaatacc attgtaccga 300 catatagcag atttagcagg gaataagaac ctcattctgc cagtcccagc ttttaacgtt 360 attaacggag gttcacatgc aggaaataaa ctggcaatgc aagaattcat gatcctaccc 420 actggagcgt gctcctttac ggaagctatg aagatgggca gcgaaactta tcataattta 480 aagaaaatta tcaaagacaa gtacggactt gatgctactg ctgtgggaga tgaaggagga 540 ttcgcaccaa acattactaa taataaagac gcgcttcaaa tcattaatga tgccatttca 600 // ID LN889240; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889240; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3960 partial Enolase gene for Enolase, isolate DE ARC3960 XX KW . XX OS Cryptorhynchini gen. sp. ARC3960 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fe7e0e1ae74ebf5fb1dfc5bd40e43b02. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Cryptorhynchini gen. sp. ARC3960" FT /isolate="ARC3960" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742682" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYR1" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYR1" FT /protein_id="CUR50071.1" FT /translation="AAVPSGASTGIHEALELRDNIPEEYVGKGVSKAVENVNKSIGPEL FT VKQNFDVTQQEEIDEFMLKLDGTDNKSNFXANAILGVSLAVCKAGAAKRGLPLYRHIAD FT LAGNKNLILPVPAFNVINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHTLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIA" XX SQ Sequence 600 BP; 189 A; 118 C; 130 G; 152 T; 11 other; gccgcagttc cttcaggtgc cagtacaggt attcatgagg ctttggaact tagagataat 60 attcctgaag agtatgtggg aaaaggagta tctaaagcag ttgaaaatgt aaacaaatct 120 attggtcctg aattggtaaa gcagaatttc gatgttactc agcaagaaga aattgacgag 180 tttatgctta aattagacgg cactgacaat aaatcaaatt ttkgtgccaa tgccatttta 240 ggagtgtctt tggcagtttg taaagctgga gctgccaaac gtggactgcc gctktatcga 300 catatagcag acttrgctgg taataaaaac cttatccttc ctgtccctgc cttcaatgtc 360 attaatgggg gytcacaygc gggaaataaa ctkgccatgc aagagttcat gattcttcca 420 actggagcct gctctttcac ggaagcyatg aaaatgggta gcgaaactta tcacactctr 480 aagaaratca tcaaagacaa atatggmctt gacgctacag cagtcggaga tgaaggcggg 540 tttgcaccaa atatyaccaa caacaaagac gcacttcaaa taatcaatga cgccatcgcc 600 // ID LN889241; SV 1; linear; genomic DNA; STD; INV; 477 BP. XX AC LN889241; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Conotrachelus sp. group 4 MB-2015 partial Enolase gene for Enolase, isolate DE ARC3969 XX KW . XX OS Conotrachelus sp. group 4 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Conotrachelus; unclassified Conotrachelus. XX RN [1] RP 1-477 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4001da60486b2a143a8021c93a7b6360. XX FH Key Location/Qualifiers FH FT source 1..477 FT /organism="Conotrachelus sp. group 4 MB-2015" FT /isolate="ARC3969" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742690" FT CDS <1..>477 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L1N3" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1N3" FT /protein_id="CUR50072.1" FT /translation="GPELVKQSFDVTQQEEIDDFMIKLDGTENKSNFGANAILGVSLAI FT CKAGAAKRGVPLYRHIADLAGNXXLILPVPAFNVINGGSHAGNKLAMQEFMXLPTGACS FT FTEAMKMGSETYHNLKKIIKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIS" XX SQ Sequence 477 BP; 149 A; 96 C; 101 G; 122 T; 9 other; gggccygarc ttgtgaagca aagttttgac gttacccagc aagaagaaat tgacgatttt 60 atgattaagc ttgatggaac cgaaaacaag tcaaatttcg gtgctaatgc tattttggga 120 gtatctttag cgatatgtaa ggctggtgct gccaaacgag gtgtaccttt atatcggcac 180 atagctgatc tagctggaaa trrrrrcctt atcctcccag tcccagcgtt caacgtcatc 240 aatggaggat ctcacgcagg taacaaattg gccatgcaag aattcatgay tctccctact 300 ggagcatgct ctttcactga agcaatgaaa atgggaagcg agacttacca taacctcaaa 360 aaaatcatca aagataarta tggacttgat gctacagcag taggtgacga gggcggtttt 420 gcaccaaata taaccaacaa taaagatgct cttcagataa tcaatgatgc tatctct 477 // ID LN889242; SV 1; linear; genomic DNA; STD; INV; 402 BP. XX AC LN889242; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulomus cf. multicostatus MB-2015 partial Enolase gene for Enolase, DE isolate ARC3970 XX KW . XX OS Eubulomus cf. multicostatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulomus. XX RN [1] RP 1-402 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8c56587f0011c875739217aed0fd6682. XX FH Key Location/Qualifiers FH FT source 1..402 FT /organism="Eubulomus cf. multicostatus MB-2015" FT /isolate="ARC3970" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738348" FT CDS <1..>402 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L137" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L137" FT /protein_id="CUR50073.1" FT /translation="GTENKSKFGANAILGISLAVCKAGAAKRGVPLYRHIADLAGNKHI FT ILPVPAFNVINGGSHAGNKLAMQEFMILPTGANSFREAMKMGSETYHTLKKIIKDKYGL FT DATAVGDEGGFAPNITNNKDALQILNDSJS" XX SQ Sequence 402 BP; 126 A; 86 C; 92 G; 93 T; 5 other; ggtaccgaaa ataaatctaa gtttggcgcc aacgcmattt taggaatttc tttagcggta 60 tgcaaagcgg gtgctgctaa acgaggagtg cccttatatc gacatatagc ggatctagca 120 ggaaataaac acatcattct gcctgtaccc gcattyaacg tgatcaacgg agggtcgcat 180 gccggaaaca aattagccat gcaagaattt atgatacttc ctactggagc aaattcgttt 240 cgcgaagcta tgaaaatggg cagtgaaacc tatcatacac ttaagaaaat tattaaggac 300 aagtatgggt tggacgcaac ggcggtgggc gatgaaggcg ggttcgcacc taacattaca 360 aacaacaarg acgccctsca aattctgaat gactccmtct cc 402 // ID LN889243; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889243; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles indigens partial Enolase gene for Enolase, isolate ARC3978 XX KW . XX OS Acalles indigens OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 59a0c992734483c2489ed4810e637c06. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Acalles indigens" FT /isolate="ARC3978" FT /mol_type="genomic DNA" FT /db_xref="taxon:1530239" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L196" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L196" FT /protein_id="CUR50074.1" FT /translation="AAVPSGASTGIHEALELRDDVPQDYLGKGVSKAVDNVNKSIGPEL FT VKQNFDVTQQEEIDXFMIKLDGTENKSNFGANAILGVSLAICKAGAAKRGVPLYRHIAD FT LAGNKNLILPVPAFNIINGGSHAGNKLAMQEFMILPTGACSFTEAMKMGSETYHTLKKL FT IKDKYGLDATAVGDEGGFAPNITNNKDALQIINDAIS" XX SQ Sequence 600 BP; 185 A; 128 C; 140 G; 145 T; 2 other; gccgcagttc cgtcaggtgc tagtaccggt attcatgaag csttagaact gagagacgat 60 gtgccacaag actatttagg aaaaggagtc agtaaggcgg tagataatgt gaataaatca 120 ataggtcctg agttggtgaa acaaaatttc gatgtcaccc aacaagaaga aatcgacgak 180 ttcatgatca agctggatgg tactgaaaat aaatcgaatt ttggtgccaa tgccatttta 240 ggagtgtctc tagctatatg caaagccggt gctgccaaaa gaggagtgcc gctttaccgt 300 catatagcgg atttagccgg aaataagaat cttatccttc ctgttccggc tttcaacatt 360 attaatgggg gctcccacgc tgggaataaa ctagccatgc aagagttcat gattcttcct 420 accggagcgt gctcttttac ggaagccatg aagatgggca gcgaaactta ccacaccctt 480 aaaaagctca tcaaagacaa gtacgggctt gacgctactg cagtgggaga cgaaggtggg 540 ttcgcaccaa atatcaccaa taataaagac gctcttcaaa tcattaacga tgccatctcc 600 // ID LN889244; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889244; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Zascelis cf. irrorata MB-2015 partial Enolase gene for Enolase, isolate DE ARC3980 XX KW . XX OS Zascelis cf. irrorata MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Zascelis. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3a0863baea1525868ed8f5bfd9fd9226. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Zascelis cf. irrorata MB-2015" FT /isolate="ARC3980" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738371" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4L3M9" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3M9" FT /protein_id="CUR50075.1" FT /translation="AAVTSGGSTGIHEALELRDEVPNEYMGKGVKKAVENVNNSIGPEL FT LNKTFDVTQQEEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILXVPAFNVXXGGSHAGNKLAMQEFMILPTGASSFQEAMKMGSETYHTLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 199 A; 119 C; 141 G; 137 T; 4 other; gctgcagtta cctcaggggg cagtacaggc atccatgaag cccttgagct cagagacgaa 60 gtgccaaatg aatatatggg aaaaggcgtt aagaaggctg tagaaaatgt aaataattct 120 attggtcccg aactgctaaa taaaaccttt gacgtgactc agcaagaaga gattgatgag 180 tttatgatta aactagatgg cacggagaat aaatcaaaat ttggcgcaaa tgccatttta 240 ggagtatctt tggcagtatg caaagctggt gctgccaaaa gaggagtgcc gttatacagg 300 catatagcag acttagcagg aaataaaaac attatcctac ytgtccccgc ttttaaygtc 360 wttaasggag gttcacatgc cggaaataag ctagcaatgc aggaatttat gattctgccc 420 actggagcaa gctccttcca ggaagctatg aagatgggca gtgaaacata tcatactctg 480 aagaaaatca ttaaagacaa atacggatta gacgccactg cagtgggcga cgaaggtggc 540 ttcgcgccga acatcaccaa caacaaggat gctcttctaa tcatcaatga tgccatcgcc 600 // ID LN889245; SV 1; linear; genomic DNA; STD; INV; 600 BP. XX AC LN889245; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acallocrates denticollis partial Enolase gene for Enolase, isolate DE ZFMK-DNA-0100405065 XX KW . XX OS Acallocrates denticollis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acallocrates. XX RN [1] RP 1-600 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bc6e9902cd622b1e9691409a77ef6726. XX FH Key Location/Qualifiers FH FT source 1..600 FT /organism="Acallocrates denticollis" FT /isolate="ZFMK-DNA-0100405065" FT /mol_type="genomic DNA" FT /db_xref="taxon:501629" FT CDS <1..>600 FT /codon_start=1 FT /transl_table=1 FT /gene="Enolase" FT /product="Enolase" FT /db_xref="GOA:A0A0S4KYM5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR020811" FT /db_xref="InterPro:IPR029017" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYM5" FT /protein_id="CUR50076.1" FT /translation="AAVPSGASTGIHEALELRDEIPEDYLGKGVSKAVDHVNNSIGPEL FT VKQNFDVTQQEEIDEFMIKLDGTENKANFGANAILGVSLAVCKAGAAKRGVPLYRHIAD FT LAGNKNIILPVPAFNVINGGSHAGNKLAMQEFMLLPTGANSFKEAMKMGXEVYHXLKKI FT IKDKYGLDATAVGDEGGFAPNITNNKDALLIINDAIA" XX SQ Sequence 600 BP; 199 A; 106 C; 130 G; 160 T; 5 other; gctgcagtcc cttcaggtgc tagtacaggt attcatgaag ctttagaact gagagatgaa 60 attccggaag attatttagg caaaggagtt tctaaagctg tcgaccatgt aaataacagt 120 atcggtcccg aattggtaaa acaaaatttc gatgtcaccc aacaagagga aatagatgaa 180 tttatgatta aattggatgg cactgaaaat aaggcaaatt ttggtgctaa tgccatccta 240 ggagtrtctc ttgctgtatg caaagctggt gcggccaaac gaggagtgcc attgtatcga 300 catatagccg atttagctgg aaataaaaac attatccttc ctgtcccagc ttttaatgtt 360 attaatggag gttcgcatgc cggaaataag ttagcaatgc aggaattcat gctcttacca 420 acaggagcca attcatttaa agaagctatg aaaatgggcr ccgaagttta tcatartcty 480 aaraaaatta ttaaagacaa gtacgggctt gacgctactg cagtaggtga tgaaggtgga 540 ttcgcaccaa atattactaa taacaaagat gcgctactaa tcatcaatga tgccatagcg 600 // ID LN889246; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889246; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pseudoporopterus sp. ARC0884 partial Histone 4 gene for Histone 4, isolate DE ARC0884 XX KW . XX OS Pseudoporopterus sp. ARC0884 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pseudoporopterus; unclassified Pseudoporopterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c9979f8a02de8297f01db1481d7c1f07. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Pseudoporopterus sp. ARC0884" FT /isolate="ARC0884" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737006" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L198" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L198" FT /protein_id="CUR50077.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 29 C; 37 G; 32 T; 8 other; gggatcacca agcccgcyat cagragrttg gcmagrcgag gaggtgtaaa acgtatttca 60 ggtttgattt acgaagaaac ccgaggagtc ytraaagtat tcttggaaaa tgttattmga 120 gatgccgtta cctacaccga gcacgcc 147 // ID LN889247; SV 1; linear; genomic DNA; STD; INV; 143 BP. XX AC LN889247; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0886 partial Histone 4 gene for Histone 4, DE isolate ARC0886 XX KW . XX OS Cryptorhynchini gen. sp. ARC0886 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-143 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 748cdf620c11e6699fdea0e492c8bd40. XX FH Key Location/Qualifiers FH FT source 1..143 FT /organism="Cryptorhynchini gen. sp. ARC0886" FT /isolate="ARC0886" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742675" FT CDS <1..>143 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1F9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1F9" FT /protein_id="CUR50078.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRNAVTY FT TE" XX SQ Sequence 143 BP; 43 A; 26 C; 42 G; 31 T; 1 other; gggatcacca agccggcaat aagaagattr gcgagacgtg gcggggtcaa acgtatatcc 60 ggtttgattt acgaagaaac gcgtggagtt ttgaaagttt tcttggagaa cgtaatcagg 120 aacgcggtca cttacacgga aca 143 // ID LN889248; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889248; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles sp. ARC0888 partial Histone 4 gene for Histone 4, isolate ARC0888 XX KW . XX OS Acalles sp. ARC0888 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles; unclassified Acalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 787a058b249737159f04099fac8e47ee. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Acalles sp. ARC0888" FT /isolate="ARC0888" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736914" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZW9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZW9" FT /protein_id="CUR50079.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 37 A; 39 C; 40 G; 31 T; 0 other; gggatcacca agcccgccat cagaagattg gccagacgcg gaggcgttaa acgtatttcc 60 ggtttgatct acgaggaaac tcgcggcgta ctgaaagttt tcttggaaaa cgtcatccgt 120 gatgccgtta cgtacaccga gcacgcc 147 // ID LN889249; SV 1; linear; genomic DNA; STD; INV; 102 BP. XX AC LN889249; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nechyrus cf. porcatus MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC0893 XX KW . XX OS Nechyrus cf. porcatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nechyrus. XX RN [1] RP 1-102 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7a301f68cb0ba3a66a019ef7d2aff294. XX FH Key Location/Qualifiers FH FT source 1..102 FT /organism="Nechyrus cf. porcatus MB-2015" FT /isolate="ARC0893" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738357" FT CDS <1..>102 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L195" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L195" FT /protein_id="CUR50080.1" FT /translation="VKRISGLIYEETRGVLKVFLENVIXDAVTYTEHA" XX SQ Sequence 102 BP; 27 A; 22 C; 22 G; 26 T; 5 other; gtcaaacgta tttccggttt aatctacgag gagactcgtg gagtcctgaa rgtrttccta 60 gaaaacgtya tcasggacgc cgttacttat accgaacayg ct 102 // ID LN889250; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889250; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Asytesta sp. cf. albifrons MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC0897 XX KW . XX OS Asytesta cf. albifrons MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Asytesta. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 69d139699de8ae1b1b98a6ce093b27f5. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Asytesta cf. albifrons MB-2015" FT /isolate="ARC0897" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738341" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYE1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYE1" FT /protein_id="CUR50081.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 39 C; 40 G; 30 T; 0 other; gggatcacca agcccgccat cagacgtttg gccagacgag gaggcgttaa gcgtatttcg 60 ggtttgattt acgaggaaac ccgcggcgta ctcaaagtat ttttggaaaa cgtcatcagg 120 gacgccgtca cttacaccga acacgcc 147 // ID LN889251; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889251; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantiala illusa partial Histone 4 gene for Histone 4, isolate ARC0900 XX KW . XX OS Pantiala illusa OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pantiala. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c966759bc6167af2fe9cb2b46e970b84. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Pantiala illusa" FT /isolate="ARC0900" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738267" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L5Q5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5Q5" FT /protein_id="CUR50082.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 30 C; 41 G; 33 T; 0 other; gggatcacca agcccgctat cagacgattg gccagacgtg gaggcgtgaa acgtatttcc 60 ggtttgatct acgaagaaac aagaggggtt ctgaaagtgt ttttagagaa cgtcatcaga 120 gatgccgtaa cttatacgga acacgct 147 // ID LN889252; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889252; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mechistocerus violatus partial Histone 4 gene for Histone 4, isolate DE ARC0908 XX KW . XX OS Mechistocerus violatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Mechistocerus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7fda6aa8b4363ff45d8436dae9cbe508. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Mechistocerus violatus" FT /isolate="ARC0908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742697" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYN3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYN3" FT /protein_id="CUR50083.1" FT /translation="GJTXPAIRRLARRGGVKRISGLIXEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 31 C; 38 G; 34 T; 4 other; gggmtcacca ascccgctat aagaagattg gccagacgtg gaggcgttaa acggatttct 60 ggtttgatmt asgaagaaac ccgcggggtt ctcaaagtgt ttttagaaaa cgtcatccga 120 gatgccgtaa cctataccga gcatgct 147 // ID LN889253; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889253; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0909 partial Histone 4 gene for Histone 4, DE isolate ARC0909 XX KW . XX OS Cryptorhynchini gen. sp. ARC0909 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 70bef35dbf309d2daae765328852475e. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchini gen. sp. ARC0909" FT /isolate="ARC0909" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742676" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3X5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3X5" FT /protein_id="CUR50084.1" FT /translation="XJXXPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVXXDAVXY FT XEHA" XX SQ Sequence 147 BP; 39 A; 26 C; 35 G; 37 T; 10 other; gsgmtcmcaa asccggctat yagaagattg gctagacgtg gtggagttaa acgtatttcg 60 ggtctaattt acgaagaaac gcgtggcgtt ttaaaggtat ttttagaaaa cgtwrtcasa 120 gatgccgtcw cttacmccga acatgcc 147 // ID LN889254; SV 1; linear; genomic DNA; STD; INV; 108 BP. XX AC LN889254; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tyrtaeosus coelosternoides partial Histone 4 gene for Histone 4, isolate DE ARC0912 XX KW . XX OS Tyrtaeosus coelosternoides OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tyrtaeosus. XX RN [1] RP 1-108 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0b8917f6cb9111e9bba1762f448ae52c. XX FH Key Location/Qualifiers FH FT source 1..108 FT /organism="Tyrtaeosus coelosternoides" FT /isolate="ARC0912" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738215" FT CDS <1..>108 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZ87" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ87" FT /protein_id="CUR50085.1" FT /translation="GGVKRISGLIYEETRGVLKVFXENVIRDAVTYTEHA" XX SQ Sequence 108 BP; 29 A; 18 C; 26 G; 22 T; 13 other; ggsggygtca arcgtatatc cggtttgata taygaagaaa ccmggggmgt tytaaargtg 60 ttcntagaaa atgtcatccg agacgcagtw acytataccg arcacgcy 108 // ID LN889255; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889255; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropteropsis cf. biconifer MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC0924 XX KW . XX OS Poropteropsis cf. biconifer MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropteropsis. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d3b72d2271f209b8a75313520377b638. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Poropteropsis cf. biconifer MB-2015" FT /isolate="ARC0924" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738363" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3F9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3F9" FT /protein_id="CUR50086.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 37 A; 31 C; 41 G; 38 T; 0 other; gggatcacca aacccgctat cagacgtttg gctagacgtg gtggtgtgaa gcgtatctcg 60 gggctgattt atgaagaaac tcgtggcgtc ctgaaagttt tcctggaaaa cgttatcagg 120 gatgcagtca cttataccga acatgct 147 // ID LN889256; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889256; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sternochetus mangiferae partial Histone 4 gene for Histone 4, isolate DE ARC0929 XX KW . XX OS Sternochetus mangiferae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Sternochetus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cca0114a2054a2ff0a270ac7b3826659. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Sternochetus mangiferae" FT /isolate="ARC0929" FT /mol_type="genomic DNA" FT /db_xref="taxon:925794" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYS4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYS4" FT /protein_id="CUR50087.1" FT /translation="GIXXPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 31 C; 43 G; 31 T; 2 other; gggatcmccm agccggccat cagaaggtta gccagacgcg gaggtgtgaa acgtatatcg 60 ggtctaatat acgaagaaac gcgtggagtt ttaaaggtgt ttctggaaaa tgtcatcagg 120 gacgccgtca cttataccga gcacgct 147 // ID LN889257; SV 1; linear; genomic DNA; STD; INV; 102 BP. XX AC LN889257; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Xychusa sp. ARC1334 partial Histone 4 gene for Histone 4, isolate ARC1334 XX KW . XX OS Xychusa sp. ARC1334 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Xychusa; unclassified Xychusa. XX RN [1] RP 1-102 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a0322a2031536b47c7ed8d0b44b61c85. XX FH Key Location/Qualifiers FH FT source 1..102 FT /organism="Xychusa sp. ARC1334" FT /isolate="ARC1334" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737028" FT CDS <1..>102 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1P9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1P9" FT /protein_id="CUR50088.1" FT /translation="VKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 102 BP; 30 A; 18 C; 25 G; 27 T; 2 other; gttaaacgta tttccggttt gatatacgaa gaaacccgtg gggtacttaa agtgtttttg 60 gaaaacgtaa tcmgggatgc sgtaacctat acggaacacg cc 102 // ID LN889258; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889258; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas patronoides partial Histone 4 gene for Histone 4, isolate DE ARC1337 XX KW . XX OS Arachnobas patronoides OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 54843112b5f906d2d8aec927026a533d. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Arachnobas patronoides" FT /isolate="ARC1337" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738223" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L155" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L155" FT /protein_id="CUR50089.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 49 A; 28 C; 42 G; 28 T; 0 other; gggatcacca agcccgccat tagaaggttg gcgaggcgcg gaggagtgaa gagaatttcc 60 ggattaatat acgaagaaac acgcggcgta ttaaaagtat ttttggaaaa cgtaattaga 120 gacgccgtaa cctatacgga acacgcg 147 // ID LN889259; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889259; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe sp. ARC1338 partial Histone 4 gene for Histone 4, isolate ARC1338 XX KW . XX OS Semiathe sp. ARC1338 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe; unclassified Semiathe. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1eb0a739ba5ca922659269a5f50fcdfb. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Semiathe sp. ARC1338" FT /isolate="ARC1338" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736949" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1A6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1A6" FT /protein_id="CUR50090.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 47 A; 24 C; 40 G; 34 T; 2 other; gggatcacca agccggcsat tagaagattg gckagacgtg gaggagtaaa acgtatttct 60 ggattgatat acgaggaaac tagaggtgtt ttgaaggtat ttctggaaaa cgttatcaga 120 gatgccgtaa cttacacaga acacgcc 147 // ID LN889260; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889260; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe cf. puncticollis MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC1340 XX KW . XX OS Semiathe cf. puncticollis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5c50f5c5119c735fa77749979f3829d7. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Semiathe cf. puncticollis MB-2015" FT /isolate="ARC1340" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738368" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3P6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3P6" FT /protein_id="CUR50091.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 27 C; 37 G; 30 T; 15 other; gggatcacca arccsgcmat mmgamgattg gccagacgag gwggcgttaa rcgtatttcs 60 ggtytgattt aygaagaaac ccgmggtgtc ctraaagtat ttttggaaaa ygtcatcagg 120 gacgctgtya cgtataccga acacgca 147 // ID LN889261; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889261; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas pauxillus partial Histone 4 gene for Histone 4, isolate ARC1343 XX KW . XX OS Arachnobas pauxillus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f26e1e5322c685f01c6b3ddf4a696d56. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Arachnobas pauxillus" FT /isolate="ARC1343" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738224" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYN9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYN9" FT /protein_id="CUR50092.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 33 C; 41 G; 33 T; 0 other; gggatcacca agcccgccat cagaagattg gctaggcgtg gaggtgtgaa gcgtatttcc 60 ggtttaatct acgaagagac ccgcggcgta ctaaaagtgt ttttagagaa cgtcattagg 120 gacgcagtta cttacaccga acatgcc 147 // ID LN889262; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889262; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Idopelma unicolor partial Histone 4 gene for Histone 4, isolate ARC1346 XX KW . XX OS Idopelma unicolor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Idopelma. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e95910cbb1982c844f4491cc5ee0ad82. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Idopelma unicolor" FT /isolate="ARC1346" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738204" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1A8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1A8" FT /protein_id="CUR50093.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIXDXVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 34 C; 37 G; 31 T; 2 other; gggatcacca agccagccat cagaagattg gccaggcgtg gtggagtaaa gcgtatttcc 60 ggcttgatct acgaagaaac ccgtggtgtc ttaaaagttt tcctagaaaa tgtgatcakg 120 gackcagtca cctatacaga acacgcc 147 // ID LN889263; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889263; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas sectator partial Histone 4 gene for Histone 4, isolate ARC1347 XX KW . XX OS Arachnobas sectator OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dfce06c2db7abe524ada336331263550. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Arachnobas sectator" FT /isolate="ARC1347" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738225" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1H5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1H5" FT /protein_id="CUR50094.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT CEHA" XX SQ Sequence 147 BP; 25 A; 47 C; 45 G; 30 T; 0 other; gggatcacca agcccgctat ccgccgcctg gctcgccgtg gtggtgtgaa gcgtatctcc 60 ggcctcatct atgaggagac ccgcggagtg ctgaaggtgt tccttgagaa cgtcatccgt 120 gacgccgtca cttactgcga gcacgcc 147 // ID LN889264; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889264; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Camptorhinus cf. dorsalis MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC1360 XX KW . XX OS Camptorhinus cf. dorsalis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Camptorhinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a54ba79b3c770e5e573279b2f9c8e16d. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Camptorhinus cf. dorsalis MB-2015" FT /isolate="ARC1360" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738342" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZY3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZY3" FT /protein_id="CUR50095.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 35 C; 38 G; 34 T; 0 other; gggatcacca aacccgccat tcgcagattg gccagacgtg gaggtgtcaa acgtatttcc 60 ggtttgatct acgaagaaac tcgtggagtg ctgaaagtat ttttggaaaa cgttatcagg 120 gatgctgtca cctacaccga acacgcc 147 // ID LN889265; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889265; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Perissops cf. apicalis MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC1361 XX KW . XX OS Perissops cf. apicalis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Perissops. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 09c1b195792bf547cdb7e9883fa91768. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Perissops cf. apicalis MB-2015" FT /isolate="ARC1361" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738362" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1B0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1B0" FT /protein_id="CUR50096.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 23 C; 38 G; 44 T; 0 other; gggatcacca aacccgctat tagaagatta gcaagacgtg gtggtgtgaa acgtatttct 60 ggattgattt atgaggaaac tcgtggtgtt ttgaaggtat ttcttgaaaa tgttatcagg 120 gatgctgtta cttacaccga acacgca 147 // ID LN889266; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889266; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mormosintes cf. nodosus MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC1362 XX KW . XX OS Mormosintes cf. nodosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Mormosintes. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 50219cee24d6e9458a7f4745ed59945e. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Mormosintes cf. nodosus MB-2015" FT /isolate="ARC1362" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738356" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYF1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYF1" FT /protein_id="CUR50097.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 40 C; 38 G; 31 T; 0 other; gggatcacta agcctgccat ccgcagattg gccagacgtg gcggcgtcaa acgtatctcc 60 ggtttgatct acgaagaaac tcgtggtgtc ctgaaagtct ttctagaaaa cgtaatcaga 120 gatgccgtca cctacaccga gcacgcg 147 // ID LN889267; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889267; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lophocheirus cf. maior MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC1364 XX KW . XX OS Lophocheirus cf. maior MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Lophocheirus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 48f11217c6669605580854651bebe78f. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Lophocheirus cf. maior MB-2015" FT /isolate="ARC1364" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738350" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L5R8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5R8" FT /protein_id="CUR50098.1" FT /translation="GITKPAIXXLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 32 C; 47 G; 28 T; 2 other; gggatcacca agcccgcgat cagkagkttg gccagacgag ggggagtgaa gcgtatttcc 60 ggtttgatat acgaagagac ccggggagta ctcaaggtgt ttttggagaa cgttattagg 120 gacgccgtaa cgtacaccga acacgcc 147 // ID LN889268; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889268; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Salcus granulatus partial Histone 4 gene for Histone 4, isolate ARC1365 XX KW . XX OS Salcus granulatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Salcus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 75d4af10a5a89144a2e615e5161da190. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Salcus granulatus" FT /isolate="ARC1365" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738283" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYP8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYP8" FT /protein_id="CUR50099.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 34 C; 39 G; 28 T; 2 other; gggatcacga agccggcaat cagaagatta gccagacgag gyggcgtgaa acgtatttcc 60 ggtctgatct acgaagaaac ccgcggagtt ctcaaagtrt ttttggaaaa cgtcatcagg 120 gacgcagtta cctataccga acacgca 147 // ID LN889269; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889269; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Autillia horridipes partial Histone 4 gene for Histone 4, isolate ARC1366 XX KW . XX OS Autillia horridipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Autillia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6d1a00fb3d54d39c22f9ff8d42143d02. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Autillia horridipes" FT /isolate="ARC1366" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738230" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3Z3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3Z3" FT /protein_id="CUR50100.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 50 A; 30 C; 36 G; 31 T; 0 other; gggatcacta aacccgccat aagaagattg gccagacgag gtggtgttaa acgtatttcc 60 ggtttaattt acgaagaaac cagaggcgta ctaaaagttt tcttggaaaa cgtaatcagg 120 gacgccgtaa catacacgga acacgca 147 // ID LN889270; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889270; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Telaugia subtilis partial Histone 4 gene for Histone 4, isolate ARC1371 XX KW . XX OS Telaugia subtilis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Telaugia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6a235e3dc1db5dd39fcff7dca344240f. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Telaugia subtilis" FT /isolate="ARC1371" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738210" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZA2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZA2" FT /protein_id="CUR50101.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 47 A; 34 C; 36 G; 30 T; 0 other; gggatcacga aacccgctat tagaagatta gccagacgcg gaggagttaa acgtatctcc 60 ggtttgatct acgaagaaac tcgaggcgtc ctcaaagtgt ttttagaaaa cgtaatcaga 120 gacgccgtaa cctatacgga acacgcc 147 // ID LN889271; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889271; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Microporopterus cf. interruptus MB-2015 partial Histone 4 gene for Histone DE 4, isolate ARC1384 XX KW . XX OS Microporopterus cf. interruptus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Microporopterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 169425fe94eb9dab6e5a0eb92f1836aa. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Microporopterus cf. interruptus MB-2015" FT /isolate="ARC1384" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738353" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3H5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3H5" FT /protein_id="CUR50102.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 31 C; 40 G; 29 T; 1 other; gggatcacga aaccagccat aagaagactg gccagacgag gtggagttaa acgtatttcc 60 ggtctaattt acgaagagac gcgtggagtg ctgaaggtgt ttttagaaaa cgtcatcaga 120 gacgcagtsa cttacaccga acacgcc 147 // ID LN889272; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889272; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Microporopterus cf. setosus MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC1392 XX KW . XX OS Microporopterus cf. setosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Microporopterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 69fc3fe4b45fa6c8b75dc81a5ce6ed26. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Microporopterus cf. setosus MB-2015" FT /isolate="ARC1392" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738354" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYX5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYX5" FT /protein_id="CUR50103.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 36 A; 39 C; 39 G; 33 T; 0 other; gggatcacca agcccgccat tcgcagattg gccagacgcg gtggcgtcaa acgtatttcc 60 ggtttgatct acgaagaaac tcgtggagtc ctgaaggtat ttttggaaaa cgttatccgg 120 gatgccgtca cctacaccga acatgcc 147 // ID LN889273; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889273; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alatidotasia sp. 1 MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC1395 XX KW . XX OS Alatidotasia sp. 1 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Alatidotasia; unclassified Alatidotasia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5901d9e4f1ccfdd8be3b5c1529826693. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Alatidotasia sp. 1 MB-2015" FT /isolate="ARC1395" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742683" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1S0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1S0" FT /protein_id="CUR50104.1" FT /translation="GITKPAIRRFARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 35 A; 39 C; 41 G; 32 T; 0 other; gggatcacca agcccgccat cagacgtttt gccagacgcg ggggcgtgaa gcgtatttcc 60 ggtttgattt acgaggaaac tcgcggcgta cttaaggtat ttctggaaaa cgttatcagg 120 gacgccgtca cttacaccga acacgcc 147 // ID LN889274; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889274; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alatidotasia sp. 2 MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC1401 XX KW . XX OS Alatidotasia sp. 2 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Alatidotasia; unclassified Alatidotasia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fe11e7e6014285691c017fbfdc20fa98. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Alatidotasia sp. 2 MB-2015" FT /isolate="ARC1401" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742684" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L180" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L180" FT /protein_id="CUR50105.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHX" XX SQ Sequence 147 BP; 36 A; 32 C; 44 G; 33 T; 2 other; gggatcacta agccggccat tagaagattg gcccgacgcg ggggcgtaaa gcgaatttcc 60 ggtttgattt acgaagagac tcgtggcgtt ctcaaggtgt ttttggagaa cgtgatcaga 120 gacgcggtta cctataccga acacscs 147 // ID LN889275; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889275; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nototrigonopterus sp. ARC1679 partial Histone 4 gene for Histone 4, isolate DE ARC1679 XX KW . XX OS Nototrigonopterus sp. ARC1679 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nototrigonopterus; unclassified Nototrigonopterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5d1ec4e351bc15d6082bc92f01cc85c6. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Nototrigonopterus sp. ARC1679" FT /isolate="ARC1679" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738291" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1C7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1C7" FT /protein_id="CUR50106.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 33 C; 37 G; 33 T; 0 other; gggatcacca agcccgctat aagaagattg gcccgacgag gaggagttaa acgtatttcc 60 ggtttgatct acgaagaaac tcgcggcgtt ttgaaagtct ttttggaaaa cgtaatacga 120 gacgccgtaa cttataccga acacgcc 147 // ID LN889276; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889276; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ectatocyba permutata partial Histone 4 gene for Histone 4, isolate ARC1897 XX KW . XX OS Ectatocyba permutata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ectatocyba. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dd428381063ae9f7445164e90315c5bd. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Ectatocyba permutata" FT /isolate="ARC1897" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738247" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3R7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3R7" FT /protein_id="CUR50107.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 29 C; 37 G; 35 T; 1 other; gggatcacta aacccgccat aagaagattg gctagacgtg gyggcgtgaa acgtatttcc 60 ggtttgattt atgaagaaac gcgcggcgtt ctaaaagttt ttctggaaaa cgttatcaga 120 gacgccgtaa cttatacaga acacgca 147 // ID LN889277; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889277; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sybulus sp. ARC1908 partial Histone 4 gene for Histone 4, isolate ARC1908 XX KW . XX OS Sybulus sp. ARC1908 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Sybulus; unclassified Sybulus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5d471def3bb67f88a6229ff1306ad2f8. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Sybulus sp. ARC1908" FT /isolate="ARC1908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737016" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYQ4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYQ4" FT /protein_id="CUR50108.1" FT /translation="GITKPAIRRWPRRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 24 C; 39 G; 36 T; 6 other; gggatcacga agccggctat cagaagatgg cctagacgtg gaggagtgaa acgtatttcs 60 ggtttaattt atgaagaaac ccgtggygtt ttraaggtat ttttggaaaa tgttatcaga 120 gacgccgtka catayaccga rcatgcc 147 // ID LN889278; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889278; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ampagia sp. ARC1917 partial Histone 4 gene for Histone 4, isolate ARC1917 XX KW . XX OS Ampagia sp. ARC1917 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ampagia; unclassified Ampagia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 779a873d591e8a4caf07c494944e96e8. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Ampagia sp. ARC1917" FT /isolate="ARC1917" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736955" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1C4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1C4" FT /protein_id="CUR50109.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 36 C; 42 G; 30 T; 0 other; gggatcacca agccggctat cagaagattg gccagacgcg gaggcgttaa acgtatttcg 60 ggtttgatct acgaagaaac ccggggcgtt ctcaaggtgt ttttggaaaa cgtgatccga 120 gacgccgtaa cctataccga acacgcc 147 // ID LN889279; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889279; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Miocalles sp. 2 MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC1918 XX KW . XX OS Miocalles sp. 2 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Miocalles; unclassified Miocalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0f58d92c46383c13918b027846118340. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Miocalles sp. 2 MB-2015" FT /isolate="ARC1918" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738355" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1J1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1J1" FT /protein_id="CUR50110.1" FT /translation="GITKPAIRRLAXXGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 28 C; 43 G; 33 T; 2 other; gggatcacca agcctgctat aaggaggttg gccrgasgcg gaggtgtaaa acgtatttcc 60 ggtttgatct acgaagaaac tagaggtgtt ctgaaagtgt ttctggagaa tgttatcagg 120 gacgcagtca cctacacgga acacgca 147 // ID LN889280; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889280; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lophocheirus sp. large species MB-2015 partial Histone 4 gene for Histone DE 4, isolate ARC1925 XX KW . XX OS Lophocheirus sp. large species MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Lophocheirus; unclassified Lophocheirus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1e15adb6af331a484e049d3818c843ad. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Lophocheirus sp. large species MB-2015" FT /isolate="ARC1925" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738351" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZZ5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZZ5" FT /protein_id="CUR50111.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 31 C; 48 G; 30 T; 0 other; gggatcacca agccggcaat caggcgactg gcgagacgtg gaggggtcaa acgtatatcc 60 ggtttgatct acgaggagac gcgtggtgta ttgaaggtgt ttttggaaaa cgtcatcagg 120 gatgccgtaa cctatacgga acacgcc 147 // ID LN889281; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889281; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas corpulentus partial Histone 4 gene for Histone 4, isolate DE ARC1930 XX KW . XX OS Arachnobas corpulentus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 83b7c5be4c983c6f64a3a5c06eb291c4. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Arachnobas corpulentus" FT /isolate="ARC1930" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738222" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1C6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1C6" FT /protein_id="CUR50112.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 35 C; 40 G; 31 T; 0 other; gggatcacca agcccgccat cagaaggtta gccagacgcg gaggtgtaaa gcgtatttcc 60 ggtttgatct acgaggagac tcgaggtgta ctaaaagtat ttttggaaaa cgtcatcagg 120 gacgccgtta cttacaccga acacgcc 147 // ID LN889282; SV 1; linear; genomic DNA; STD; INV; 135 BP. XX AC LN889282; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropteropsis sp. ARC1933 partial Histone 4 gene for Histone 4, isolate DE ARC1933 XX KW . XX OS Poropteropsis sp. ARC1933 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropteropsis; unclassified Poropteropsis. XX RN [1] RP 1-135 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 32adf5679175db63485f72654be8ee55. XX FH Key Location/Qualifiers FH FT source 1..135 FT /organism="Poropteropsis sp. ARC1933" FT /isolate="ARC1933" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737000" FT CDS <1..>135 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYG2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYG2" FT /protein_id="CUR50113.1" FT /translation="PAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA FT " XX SQ Sequence 135 BP; 36 A; 34 C; 31 G; 32 T; 2 other; cccgcsataa gaagattggc ccgacgtgga ggcgttaaac gtatttctgg tctcatttac 60 gaagaaaccc gtggcgttct caaagttttt ttagaaaacg tcatccgaga cgcagttacc 120 tacaccgagc acgcs 135 // ID LN889283; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889283; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Atopomacer podocarpi partial Histone 4 gene for Histone 4, isolate ARC1940 XX KW . XX OS Atopomacer podocarpi OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Nemonychidae; OC Atopomacer. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 055121e13e2dd29e5e4931cb3c211ec3. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Atopomacer podocarpi" FT /isolate="ARC1940" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738228" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L5T5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5T5" FT /protein_id="CUR50114.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 32 C; 43 G; 31 T; 0 other; gggatcacca aacccgctat cagaagattg gccagacgcg gaggtgtaaa gcgtatttcc 60 ggtttgattt acgaagaaac ccgaggtgtt ctgaaagtgt ttttggagaa cgtgatcagg 120 gacgcggtga catacaccga acacgcc 147 // ID LN889284; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889284; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sipalinus gigas partial Histone 4 gene for Histone 4, isolate ARC1949 XX KW . XX OS Sipalinus gigas OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Dryophthorinae; Sipalinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 92603b4a15e5718631ebc0056e1242ed. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Sipalinus gigas" FT /isolate="ARC1949" FT /mol_type="genomic DNA" FT /db_xref="taxon:1078824" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYQ9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYQ9" FT /protein_id="CUR50115.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 26 C; 39 G; 36 T; 0 other; gggatcacta aaccggctat aaggagatta gccagacgcg gcggtgtcaa acgtatatcc 60 ggtttgattt atgaagaaac tcgtggagtt ttaaaagtat tcttggaaaa cgtaatcagg 120 gacgcggtta catatacgga acacgct 147 // ID LN889285; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889285; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Psepholax cf. egerius/mastersii MB-2015 partial Histone 4 gene for Histone DE 4, isolate ARC2065 XX KW . XX OS Psepholax cf. egerius/mastersii MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Psepholax. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 979722bbc3dcc83ac3c7b51b40d06c12. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Psepholax cf. egerius/mastersii MB-2015" FT /isolate="ARC2065" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738364" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L411" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L411" FT /protein_id="CUR50116.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 34 C; 40 G; 32 T; 0 other; gggatcacaa agcccgctat cagaagattg gccagacgcg gcggcgttaa acgcatatcc 60 ggtttgattt acgaagagac tcgcggcgtt ctgaaggtat ttttagaaaa cgtcatcaga 120 gatgcggtta cttacacgga acacgcc 147 // ID LN889286; SV 1; linear; genomic DNA; STD; INV; 141 BP. XX AC LN889286; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Enteles vigorsi partial Histone 4 gene for Histone 4, isolate ARC2066 XX KW . XX OS Enteles vigorsii OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Enteles. XX RN [1] RP 1-141 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 44f1d528828b9b16d1106b74d51cd9a0. XX FH Key Location/Qualifiers FH FT source 1..141 FT /organism="Enteles vigorsii" FT /isolate="ARC2066" FT /mol_type="genomic DNA" FT /db_xref="taxon:1482114" FT CDS <1..>141 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZB6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZB6" FT /protein_id="CUR50117.1" FT /translation="TXPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE FT HA" XX SQ Sequence 141 BP; 38 A; 32 C; 36 G; 34 T; 1 other; accamgcccg ctattagaag attggcacga cgtggaggtg ttaaacgtat atccggtctt 60 atttacgaag agacccgagg tgtcctgaag gtatttttgg aaaacgttat cagagatgct 120 gtcacctaca ccgagcacgc c 141 // ID LN889287; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889287; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus humeralis partial Histone 4 gene for Histone 4, isolate ARC2067 XX KW . XX OS Poropterus humeralis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 29dfd0485ed8670571b42de0418a012e. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Poropterus humeralis" FT /isolate="ARC2067" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742656" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3I9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3I9" FT /protein_id="CUR50118.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 34 C; 40 G; 32 T; 0 other; gggatcacca agcccgccat cagaagattg gccagacgtg gaggcgttaa acgtatttct 60 ggtctgatat acgaagagac ccgtggagta cttaaagtat ttctggaaaa tgtgatcagg 120 gacgccgtta cttacaccga gcacgcc 147 // ID LN889288; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889288; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Perissops ochreonotatus partial Histone 4 gene for Histone 4, isolate DE ARC2068 XX KW . XX OS Perissops ochreonotatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Perissops. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0ed5995e06d752cb54abde446022eee4. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Perissops ochreonotatus" FT /isolate="ARC2068" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738206" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYZ3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYZ3" FT /protein_id="CUR50119.1" FT /translation="GJXXPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 32 C; 42 G; 31 T; 3 other; gggmtcmcca asccagcgat caggagatta gccagacgcg gaggagttaa gcgtatttcc 60 ggtttgattt acgaagagac ccgtggagtg ttgaaggttt ttctggaaaa cgtcatcaga 120 gacgccgtaa cctatacgga acacgcc 147 // ID LN889289; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889289; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eutyrhinus meditabundus partial Histone 4 gene for Histone 4, isolate DE ARC2069 XX KW . XX OS Eutyrhinus meditabundus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eutyrhinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1cbcc579978dddcfbe634bc8a09f466d. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Eutyrhinus meditabundus" FT /isolate="ARC2069" FT /mol_type="genomic DNA" FT /db_xref="taxon:1482124" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1T7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1T7" FT /protein_id="CUR50120.1" FT /translation="GXXKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 36 C; 42 G; 27 T; 2 other; gggrtcmcca aacccgccat cagacggttg gccagacgag gaggtgtcaa gagaatttcc 60 ggattgatct acgaggagac tcgaggagta ttaaaggtct tcctagaaaa tgtcatcagg 120 gacgccgtga cttacaccga gcacgcc 147 // ID LN889290; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889290; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Camptorhinus sp. ARC2070 partial Histone 4 gene for Histone 4, isolate DE ARC2070 XX KW . XX OS Camptorhinus sp. ARC2070 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Camptorhinus; unclassified Camptorhinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 02c269ad1df5fc143273731d1713195f. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Camptorhinus sp. ARC2070" FT /isolate="ARC2070" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736921" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L194" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L194" FT /protein_id="CUR50121.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 50 A; 26 C; 37 G; 34 T; 0 other; gggatcacta agccggcaat aagacgttta gcaagaagag gtggcgtaaa acgtatatct 60 ggtttgatct acgaagaaac cagaggtgtc ctaaaagtgt ttctcgaaaa cgttatcaga 120 gatgcagtaa cgtataccga acatgct 147 // ID LN889291; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889291; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhadinomerus sp. ARC2071 partial Histone 4 gene for Histone 4, isolate DE ARC2071 XX KW . XX OS Rhadinomerus sp. ARC2071 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Aedemonini; Rhadinomerus; unclassified Rhadinomerus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a044f291a58cb533e1018f8923957c74. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Rhadinomerus sp. ARC2071" FT /isolate="ARC2071" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736947" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1E2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1E2" FT /protein_id="CUR50122.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 34 C; 38 G; 31 T; 0 other; gggatcacca aaccggcaat taggagattg gccagacgcg gaggcgttaa acgtatctcc 60 ggtttgatct acgaagagac ccgcggcgtt ctaaaagtat ttttggaaaa cgtaatcaga 120 gacgctgtaa cttataccga acacgcc 147 // ID LN889292; SV 1; linear; genomic DNA; STD; INV; 111 BP. XX AC LN889292; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Car cf. condensatus MB-2015 MB-2015partial Histone 4 gene for Histone 4, DE isolate ARC2073 XX KW . XX OS Car cf. condensatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Caridae; Car. XX RN [1] RP 1-111 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e229ee7e8893c9735a410741fabf8c35. XX FH Key Location/Qualifiers FH FT source 1..111 FT /organism="Car cf. condensatus MB-2015" FT /isolate="ARC2073" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738343" FT CDS <1..>111 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3T2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3T2" FT /protein_id="CUR50123.1" FT /translation="RGGIKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 111 BP; 35 A; 23 C; 28 G; 25 T; 0 other; cgcggaggaa taaaacgtat ttcgggttta atttacgaag aaacgcgagg cgttctaaaa 60 gtatttttgg aaaacgttat cagggacgcc gtgacctaca ccgaacacgc c 111 // ID LN889293; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889293; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhynchites auratus partial Histone 4 gene for Histone 4, isolate ARC2098 XX KW . XX OS Rhynchites auratus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Attelabidae; OC Rhynchitinae; Rhynchites. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f3d5805c50df7c872c7e50b16ed35e63. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Rhynchites auratus" FT /isolate="ARC2098" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:614235" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYS3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYS3" FT /protein_id="CUR50124.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 29 C; 41 G; 33 T; 1 other; gggatcacta agccggcgat cagaagattg gccagacgtg gaggcgttaa acgtatttcc 60 ggtttgattt acgaagaaac gcgaggcgtt ctgaaagtat ttttggaaaa cgtcatyaga 120 gacgcagtca cttatacgga acacgcc 147 // ID LN889294; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889294; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Scelodolichus cf. lineithorax MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC2162 XX KW . XX OS Scelodolichus cf. lineithorax MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Scelodolichus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 74fbfb6714cef5f55ff18ddd9a5ae7bf. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Scelodolichus cf. lineithorax MB-2015" FT /isolate="ARC2162" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738366" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1E1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1E1" FT /protein_id="CUR50125.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 47 A; 25 C; 38 G; 37 T; 0 other; gggatcacga aaccggccat cagaagattg gcgagacgtg gaggtgtaaa acgtatttct 60 ggattaattt acgaagaaac tcgtggggtt ttaaaagttt ttctagaaaa cgtaattaga 120 gatgccgtca cttataccga acacgcg 147 // ID LN889295; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889295; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Agacalles cf. formosus MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC2171 XX KW . XX OS Agacalles cf. formosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Agacalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 392b31c5cb07c361613ecdefc9809f6c. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Agacalles cf. formosus MB-2015" FT /isolate="ARC2171" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738339" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1K4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1K4" FT /protein_id="CUR50126.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 29 C; 40 G; 30 T; 7 other; gggatcacta agcccgcyat cagaagattg gccaggcgcg gsggagtmaa acgyatttcc 60 ggtttgatat acgaagaaac scgtggygtt cttaaagtgt ttctcgaaaa tgtmatcaga 120 gacgcggtaa cctatacgga acacgcg 147 // ID LN889296; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889296; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Crisius fasciculatus partial Histone 4 gene for Histone 4, isolate ARC2179 XX KW . XX OS Crisius fasciculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Crisius. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0716ba65d6b7c7596a0e31eac339b614. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Crisius fasciculatus" FT /isolate="ARC2179" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738236" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L007" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L007" FT /protein_id="CUR50127.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 33 C; 37 G; 32 T; 1 other; gggatcacta aaccggccat cagacgattg gcacgacgag gaggcgtaaa acgtatctcc 60 ggtttgatct acgaagaaac ccgcggcgtt ttaaaagtat ttttggaaaa cgtgatcaga 120 gatgccgtta cttataccga acacgcm 147 // ID LN889297; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889297; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dermothrius farinosus partial Histone 4 gene for Histone 4, isolate ARC2182 XX KW . XX OS Dermothrius farinosus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Dermothrius. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 63e569de338197a2827b748908c912b4. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Dermothrius farinosus" FT /isolate="ARC2182" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738245" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1E4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1E4" FT /protein_id="CUR50128.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 33 C; 39 G; 30 T; 0 other; gggatcacca agcccgcaat tagaagattg gcgagacgcg gaggagtgaa acgtatttcc 60 ggtttgatct acgaagaaac tcgcggcgta ctcaaagtat ttttggaaaa cgttatcaga 120 gacgccgtaa cctatacgga acacgcc 147 // ID LN889298; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889298; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Crooktacalles abruptus partial Histone 4 gene for Histone 4, isolate DE ARC2183 XX KW . XX OS Crooktacalles abruptus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Crooktacalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 80be3eca12eff71bc0ead376dddfa40e. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Crooktacalles abruptus" FT /isolate="ARC2183" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738239" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYH4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYH4" FT /protein_id="CUR50129.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 34 C; 43 G; 32 T; 0 other; gggatcacta agcccgccat caggaggttg gccagacgcg gaggagtgaa acgtatttcc 60 ggtttgattt acgaagaaac ccgtggcgtg ttgaaggtgt ttctcgaaaa cgttatcagg 120 gacgccgtaa cctataccga acatgcc 147 // ID LN889299; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889299; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Trinodicalles cf. cristatus/mimus MB-2015 partial Histone 4 gene for DE Histone 4, isolate ARC2185 XX KW . XX OS Trinodicalles cf. cristatus/mimus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Trinodicalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d4496fd5c25e6bbe4bbee936a2adb574. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Trinodicalles cf. cristatus/mimus MB-2015" FT /isolate="ARC2185" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738370" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L5V2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5V2" FT /protein_id="CUR50130.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 28 C; 44 G; 30 T; 0 other; gggatcacga agccagctat aaggaggctt gcaaggcgag gcggggtaaa acgtatatcc 60 ggattaatat atgaagaaac acgaggtgtt cttaaagtgt ttttggagaa tgtgatccgg 120 gacgccgtaa catacaccga gcacgcc 147 // ID LN889300; SV 1; linear; genomic DNA; STD; INV; 129 BP. XX AC LN889300; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini cf. Kirschia sp. ARC2346 partial Histone 4 gene for Histone DE 4, isolate ARC2346 XX KW . XX OS Cryptorhynchini cf. Kirschia sp. ARC2346 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-129 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2d56c6404b6f18edca86afc679f3c53d. XX FH Key Location/Qualifiers FH FT source 1..129 FT /organism="Cryptorhynchini cf. Kirschia sp. ARC2346" FT /isolate="ARC2346" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742670" FT CDS <1..>129 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYS7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYS7" FT /protein_id="CUR50131.1" FT /translation="IRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 129 BP; 36 A; 21 C; 40 G; 30 T; 2 other; atcagaagat tggccagacg tggcggcgtc aagcgtatat ctggattgat ttacgaagag 60 acgcgcggag ttytgaaggt tttyttggaa aatgtaatca gggacgcggt aacttatacg 120 gaacacgcg 129 // ID LN889301; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889301; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus lapathi partial Histone 4 gene for Histone 4, isolate DE ARC2551 XX KW . XX OS Cryptorhynchus lapathi (poplar-and-willow borer) OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f70014937ef242bb7d8537b357b7cc93. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchus lapathi" FT /isolate="ARC2551" FT /mol_type="genomic DNA" FT /db_xref="taxon:201897" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L431" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L431" FT /protein_id="CUR50132.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 35 C; 44 G; 28 T; 0 other; gggatcacga agcccgcgat cagaagattg gccagacgag gaggcgttaa acgtatttcc 60 ggtttgatct acgaggagac gcgaggcgta ctgaaagtat tcttggagaa cgttattagg 120 gacgccgtca cctacaccga acacgcc 147 // ID LN889302; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889302; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Gasterocercus depressirostris partial Histone 4 gene for Histone 4, isolate DE ARC2552 XX KW . XX OS Gasterocercus depressirostris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Gasterocercus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4a5077a0512d096d4dbe352f9e0ca25d. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Gasterocercus depressirostris" FT /isolate="ARC2552" FT /mol_type="genomic DNA" FT /db_xref="taxon:201926" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZD0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZD0" FT /protein_id="CUR50133.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 32 C; 39 G; 31 T; 1 other; gggatcacta aaccagcgat cagaaggctc gccmgacgag gaggggtaaa acgtatttcc 60 ggtttaattt acgaggagac gcgtggcgta ctcaaagtat ttttagaaaa cgtaatcaga 120 gacgccgtta cttataccga gcacgcc 147 // ID LN889303; SV 1; linear; genomic DNA; STD; INV; 141 BP. XX AC LN889303; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alcidodes elegans partial Histone 4 gene for Histone 4, isolate ARC2555 XX KW . XX OS Alcidodes elegans OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Alcidinae; Alcidodes. XX RN [1] RP 1-141 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 12503a3c267e49f71e34d4b2ebb0bfe2. XX FH Key Location/Qualifiers FH FT source 1..141 FT /organism="Alcidodes elegans" FT /isolate="ARC2555" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738163" FT CDS <1..>141 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3L9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3L9" FT /protein_id="CUR50134.1" FT /translation="TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE FT HA" XX SQ Sequence 141 BP; 43 A; 28 C; 40 G; 28 T; 2 other; actaaaccgg cgatcagaag gttggccmga cgcggcggcg ttaaaagaat atcgggactg 60 atttacgaag aaactcgagg agtcttgaag gtatttttgg aaaacgtaat cagggacgcg 120 gttacctata ccgaacacgc m 141 // ID LN889304; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889304; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Aclees indignus partial Histone 4 gene for Histone 4, isolate ARC2557 XX KW . XX OS Aclees indignus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Aclees. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 53a987e4081ae0ffe2c07f203d341dc3. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Aclees indignus" FT /isolate="ARC2557" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738218" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZ09" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ09" FT /protein_id="CUR50135.1" FT /translation="GIXKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 36 C; 39 G; 32 T; 1 other; gggatcmcca agcccgctat cagaagattg gccagacgcg gaggtgttaa acgtatttcc 60 ggtctgattt acgaagagac ccgtggcgtc ctgaaggtgt ttctagaaaa cgttatcaga 120 gacgctgtaa cctataccga acacgcc 147 // ID LN889305; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889305; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantoxystus rubricollis partial Histone 4 gene for Histone 4, isolate DE ARC2558 XX KW . XX OS Pantoxystus rubricollis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Cleogonini; Pantoxystus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e06bec906cecfe6dec729ca737e3ea1b. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Pantoxystus rubricollis" FT /isolate="ARC2558" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738269" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1V6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1V6" FT /protein_id="CUR50136.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 37 C; 43 G; 28 T; 0 other; gggatcacta aacccgccat caggagactg gccagacgcg gtggagtaaa acgtatttcc 60 ggtttgatct acgaggaaac gcgcggcgtt ctgaaggtgt tcctggaaaa cgtcatcaga 120 gacgccgtga cctatacgga acacgct 147 // ID LN889306; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889306; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neolaemosaccus cf. petulans MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC2560 XX KW . XX OS Neolaemosaccus cf. petulans MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Mesoptiliini; Neolaemosaccus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7f0e7298490f6aa175eee18793c97d90. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Neolaemosaccus cf. petulans MB-2015" FT /isolate="ARC2560" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738359" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1B5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1B5" FT /protein_id="CUR50137.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 38 A; 26 C; 42 G; 40 T; 1 other; gggatcacaa agcctgcgat tagaaggctt gcccgacgag gaggcgttaa acgtatttcg 60 ggtttgattt atgaagaaac tcgcggtgtt ctgaaggtrt ttttggaaaa tgtaattcgg 120 gacgctgtta cgtataccga acatgcc 147 // ID LN889307; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889307; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Orthorhinus (Homorthorrhinus) sp. ARC2561 partial Histone 4 gene for DE Histone 4, isolate ARC2561 XX KW . XX OS Orthorhinus (Homorthorrhinus) sp. ARC2561 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Orthorhinini; Orthorhinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 653d9c0995d223682e4e0d09ed3efcc8. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Orthorhinus (Homorthorrhinus) sp. ARC2561" FT /isolate="ARC2561" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738302" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1G2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1G2" FT /protein_id="CUR50138.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 49 A; 26 C; 39 G; 33 T; 0 other; gggatcacca aaccggcaat tagaaggttg gcaagacgtg gcggcgttaa gcgaatatcc 60 ggtttaattt acgaagaaac acgtggagtt ttaaaagtgt ttttagagaa cgtaatcaga 120 gacgcagtta cttacacgga acacgca 147 // ID LN889308; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889308; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Heilipodus sp. ARC2566 partial Histone 4 gene for Histone 4, isolate DE ARC2566 XX KW . XX OS Heilipodus sp. ARC2566 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Heilipodus; unclassified Heilipodus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 71f65f155a84bbfa0f98cd6554548909. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Heilipodus sp. ARC2566" FT /isolate="ARC2566" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736944" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3U7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3U7" FT /protein_id="CUR50139.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 48 A; 31 C; 37 G; 31 T; 0 other; gggatcacca agccagccat cagaagattg gccagacgag gaggtgtcaa gcgtatctcc 60 ggtttaattt acgaagaaac ccgaggtgta ttaaaagtat ttttggaaaa cgtcatcagg 120 gatgcagtaa catacaccga acacgct 147 // ID LN889309; SV 1; linear; genomic DNA; STD; INV; 105 BP. XX AC LN889309; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Hylobius piceus partial Histone 4 gene for Histone 4, isolate ARC2569 XX KW . XX OS Hylobius piceus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Hylobius. XX RN [1] RP 1-105 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dbbe3496b239718854d6ee375a91ad86. XX FH Key Location/Qualifiers FH FT source 1..105 FT /organism="Hylobius piceus" FT /isolate="ARC2569" FT /mol_type="genomic DNA" FT /db_xref="taxon:1002011" FT CDS <1..>105 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYT8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYT8" FT /protein_id="CUR50140.1" FT /translation="GVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 105 BP; 32 A; 11 C; 22 G; 36 T; 4 other; ggtgtaaaac gtatttccgg tttaatatat gaagaaactc gtggygtttt aaaggtattt 60 ttrgaaaayg ttattagaga tgccgtyact tatactgaac atgct 105 // ID LN889310; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889310; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Liparus tenebrioides partial Histone 4 gene for Histone 4, isolate ARC2570 XX KW . XX OS Liparus tenebrioides OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Molytini; Liparus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d85baa99bf38712152baad6302a381ed. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Liparus tenebrioides" FT /isolate="ARC2570" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738205" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1G0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1G0" FT /protein_id="CUR50141.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 35 C; 39 G; 31 T; 3 other; gggatcacca agcccgctat tagaagattg gccmgacgsg gaggcgtcaa acgtatctcc 60 ggcttgattt acgaagaaac acgcggcgtt ctcaaggtgt ttttggaaaa cgtaatcaga 120 gacgcsgtta cctataccga gcacgct 147 // ID LN889311; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889311; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alcidodes sp. ARC2603 partial Histone 4 gene for Histone 4, isolate ARC2603 XX KW . XX OS Alcidodes sp. ARC2603 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Alcidinae; Alcidodes. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1c3b3ceffb3026a0d5282daa2baeeef3. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Alcidodes sp. ARC2603" FT /isolate="ARC2603" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736953" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1L7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1L7" FT /protein_id="CUR50142.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 29 C; 40 G; 35 T; 0 other; gggatcacta agccagccat tagaagattg gcaagacgtg gcggcgtaaa gcgtatatct 60 ggtttgatat atgaagagac gcgtggcgtc ttaaaagtat tcttggagaa cgttatcaga 120 gatgccgtta cctacaccga acatgcc 147 // ID LN889312; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889312; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC2604 partial Histone 4 gene for Histone 4, DE isolate ARC2604 XX KW . XX OS Cryptorhynchini gen. sp. ARC2604 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 91b46dbec20ce6f3d9f12a896361f217. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchini gen. sp. ARC2604" FT /isolate="ARC2604" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742678" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L029" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L029" FT /protein_id="CUR50143.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 29 C; 44 G; 28 T; 0 other; gggatcacaa agccggcaat tagaagattg gccagacgtg gaggagtaaa gcgtatatcc 60 ggcttgatat acgaagaaac gcgaggtgtc ctgaaggtgt tcttggaaaa cgtgatcaga 120 gacgcagtta cttacaccga gcacgca 147 // ID LN889313; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889313; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pimelocerus sp. (Dyscerus) ARC2609 partial Histone 4 gene for Histone 4, DE isolate ARC2609 XX KW . XX OS Pimelocerus sp. (Dyscerus) ARC2609 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Pimelocerus; unclassified Pimelocerus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0aeee6fc75b251aebdcf54c0ebea2bcf. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Pimelocerus sp. (Dyscerus) ARC2609" FT /isolate="ARC2609" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742673" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1G5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1G5" FT /protein_id="CUR50144.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 27 C; 41 G; 34 T; 0 other; gggatcacga aaccggctat cagaagattg gcaagacgtg gaggagtgaa acgtatttcc 60 ggattaattt atgaagaaac tcgtggtgta ttgaaggtgt tcctagagaa cgtaatcagg 120 gacgccgtta cttataccga acacgcc 147 // ID LN889314; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889314; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paramecops (sensu lato) sp. ARC2615 partial Histone 4 gene for Histone 4, DE isolate ARC2615 XX KW . XX OS Paramecops (sensu lato) sp. ARC2615 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Paramecops. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; de2147f82a8d7e52bec9a79f979453f9. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Paramecops (sensu lato) sp. ARC2615" FT /isolate="ARC2615" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738372" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYJ1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYJ1" FT /protein_id="CUR50145.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 37 A; 35 C; 43 G; 30 T; 2 other; gggatcacca agccygcaat caggagattg gctcgtcgcg gtggcgtgaa acgtatatcc 60 ggtctcatmt atgaagaaac ccgtggagtc ttgaaggtgt ttctagagaa cgtcatcagg 120 gacgccgtca cgtatacgga acacgcc 147 // ID LN889315; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889315; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Seleuca cf. setosula MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC2616 XX KW . XX OS Seleuca cf. setosula MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Lithinini; Seleuca. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2d86f64f190cd8e8708054cc39a6be69. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Seleuca cf. setosula MB-2015" FT /isolate="ARC2616" FT /mol_type="genomic DNA" FT /db_xref="taxon:1743268" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L5X0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5X0" FT /protein_id="CUR50146.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIXDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 35 C; 42 G; 29 T; 1 other; gggatcacca agccggcaat cagaagattg gcgagacgcg gaggtgtgaa acgtatttct 60 ggcttaatct acgaagagac gcgcggcgtt cttaaggtgt ttctggaaaa tgtcatcrga 120 gacgccgtaa cctacaccga acacgcc 147 // ID LN889316; SV 1; linear; genomic DNA; STD; INV; 138 BP. XX AC LN889316; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Praodes sp. ARC2619 partial Histone 4 gene for Histone 4, isolate ARC2619 XX KW . XX OS Praodes sp. ARC2619 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Praodes; unclassified Praodes. XX RN [1] RP 1-138 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8f736302cfa5418da6929498cc3c78a1. XX FH Key Location/Qualifiers FH FT source 1..138 FT /organism="Praodes sp. ARC2619" FT /isolate="ARC2619" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737002" FT CDS <1..>138 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYT7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYT7" FT /protein_id="CUR50147.1" FT /translation="XPXIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEH FT A" XX SQ Sequence 138 BP; 41 A; 22 C; 40 G; 33 T; 2 other; magccgscaa taagacggtt agcgagacgt ggcggagtta agcgtatatc tggcttgatt 60 tacgaagaaa cgcgtggagt tttaaaggtt tttttggaaa acgtaataag ggatgcggtc 120 acctatacgg aacacgca 138 // ID LN889317; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889317; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Setarhynchus sp. ARC2626 partial Histone 4 gene for Histone 4, isolate DE ARC2626 XX KW . XX OS Setarhynchus sp. ARC2626 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Setarhynchus; unclassified Setarhynchus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 96f98677143ffca5e052dcc0f410ca79. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Setarhynchus sp. ARC2626" FT /isolate="ARC2626" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742701" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L446" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L446" FT /protein_id="CUR50148.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 31 C; 40 G; 30 T; 0 other; gggatcacga agccggccat tagaagatta gccagaagag gaggcgtgaa acgtatttcc 60 ggattgattt acgaagaaac acgaggcgtt ctcaaggtat tcttggaaaa cgtaatcagg 120 gacgccgtta cctataccga acacgct 147 // ID LN889318; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889318; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semnorhynchus cayennensis partial Histone 4 gene for Histone 4, isolate DE ARC2627 XX KW . XX OS Semnorhynchus cayennensis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semnorhynchus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 297a72ea05c5ae803d9cc252612ef3f6. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Semnorhynchus cayennensis" FT /isolate="ARC2627" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738209" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZE4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZE4" FT /protein_id="CUR50149.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 35 C; 45 G; 28 T; 0 other; gggatcacca agccggcaat caggaggctg gccagacgcg gcggagtaaa gcgtatctcc 60 ggtttgattt acgaggaaac tcgaggggtc ttgaaagtgt ttttggaaaa cgtcatcaga 120 gacgccgtta cctacaccga acacgcg 147 // ID LN889319; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889319; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus sp. ARC2629 partial Histone 4 gene for Histone 4, isolate DE ARC2629 XX KW . XX OS Cryptorhynchus sp. ARC2629 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus; unclassified Cryptorhynchus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cbd2a2da844bfb435dfe7774d7695015. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchus sp. ARC2629" FT /isolate="ARC2629" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736923" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3N4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3N4" FT /protein_id="CUR50150.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 49 A; 28 C; 38 G; 32 T; 0 other; gggatcacaa aaccggctat cagaagattg gccagacgag gtggagtaaa acgtatttct 60 ggtttaattt acgaggaaac gcgtggagta ctcaaagtat ttctggaaaa tgtaatcaga 120 gacgccgtaa cttacacgga acacgcc 147 // ID LN889320; SV 1; linear; genomic DNA; STD; INV; 114 BP. XX AC LN889320; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulus sp. ARC2631 partial Histone 4 gene for Histone 4, isolate ARC2631 XX KW . XX OS Eubulus sp. ARC2631 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulus; unclassified Eubulus. XX RN [1] RP 1-114 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4abb8e295fd8c11022f1aa51be69741b. XX FH Key Location/Qualifiers FH FT source 1..114 FT /organism="Eubulus sp. ARC2631" FT /isolate="ARC2631" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736925" FT CDS <1..>114 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZ26" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ26" FT /protein_id="CUR50151.1" FT /translation="RRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 114 BP; 33 A; 24 C; 31 G; 24 T; 2 other; cgacgrgggg gsgtaaaacg tatttccgga ttgatttacg aagagactcg aggcgttctc 60 aaagtattct tggaaaacgt aatcagggac gccgtaacct ataccgaaca cgcg 114 // ID LN889321; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889321; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lyterius sp. ARC2922 partial Histone 4 gene for Histone 4, isolate ARC2922 XX KW . XX OS Lyterius sp. ARC2922 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Baridinae; Lyterius; unclassified Lyterius. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e84c988348b319cd0a96c70da69989ca. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Lyterius sp. ARC2922" FT /isolate="ARC2922" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736980" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1W8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1W8" FT /protein_id="CUR50152.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 32 C; 42 G; 31 T; 0 other; gggatcacga agccggcgat tagaagattg gccagaagag gcggcgttaa acgtatttcc 60 ggtttgattt acgaagaaac ccgcggcgtt ctcaaagtat ttttggaaaa cgtaatcagg 120 gacgcggtga cctacaccga acacgct 147 // ID LN889322; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889322; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ectatorrhinus alatus partial Histone 4 gene for Histone 4, isolate ARC3414 XX KW . XX OS Ectatorrhinus alatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Ectatorrhinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bc8b91d5ae2736f459e5955fe7a78e70. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Ectatorrhinus alatus" FT /isolate="ARC3414" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738249" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1D0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1D0" FT /protein_id="CUR50153.1" FT /translation="GXXKPAIRRLXRRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 37 C; 37 G; 28 T; 4 other; gggrtcmcca agccggcaat cmgaagactg gstagacgtg gaggcgttaa acgtatctcc 60 ggtttaatct acgaagagac ccgcggcgtc ctaaaagtgt ttttagaaaa cgtcatcaga 120 gacgccgtaa cctataccga acacgcc 147 // ID LN889323; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889323; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paleticus subereus partial Histone 4 gene for Histone 4, isolate ARC3487 XX KW . XX OS Paleticus subereus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Paleticus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2c127f68484e72eb9e8c354aed2f0978. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Paleticus subereus" FT /isolate="ARC3487" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738263" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1H8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1H8" FT /protein_id="CUR50154.1" FT /translation="GXTKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 28 C; 43 G; 30 T; 1 other; gggvtcacga agccggcgat cagaagatta gccagacgag gaggcgtaaa gcgtatttcg 60 gggttgatat acgaggaaac gcgaggcgtt ctcaaagtat ttttggaaaa cgttattaga 120 gacgccgtca cttatacaga acacgca 147 // ID LN889324; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889324; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ephrycus sp. ARC3491 partial Histone 4 gene for Histone 4, isolate ARC3491 XX KW . XX OS Ephrycus sp. ARC3491 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ephrycus; unclassified Ephrycus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9c2f2eaae9aac056ea6527dbbe8337bc. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Ephrycus sp. ARC3491" FT /isolate="ARC3491" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736966" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3W1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3W1" FT /protein_id="CUR50155.1" FT /translation="GITKPXIXRLXRRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 32 C; 37 G; 29 T; 3 other; gggatcacga aaccgsccat cygtagactg gsgagacgtg gaggagtgaa acgtatctcc 60 gggttaatct atgaagaaac ccgcggagta ttaaaagtat ttctcgaaaa cgtaatcaga 120 gacgccgtta cttataccga acacgcc 147 // ID LN889325; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889325; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eupanteos sp. n. 1 MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC3499 XX KW . XX OS Eupanteos sp. n. 1 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Anthribidae; OC Anthribinae; Sintorini; Eupanteos; unclassified Eupanteos. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c82a534bf9caf62b098504dfbc91ca67. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Eupanteos sp. n. 1 MB-2015" FT /isolate="ARC3499" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738349" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYV1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYV1" FT /protein_id="CUR50156.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEXA" XX SQ Sequence 147 BP; 47 A; 29 C; 38 G; 31 T; 2 other; gggatcacca agccagcaat cagaagattg gcaagacgag gaggcgtaaa acgtatatcc 60 ggtttgattt acgaagaaac gcgtggagtt ctaaaagtgt ttttggaaaa tgtratcaga 120 gacgccgtca cttataccga acrcgcc 147 // ID LN889326; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889326; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ochyromera cf. sericea MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC3518 XX KW . XX OS Ochyromera cf. sericea MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Tychiini; Ochyromera. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5e7276149839690b940ab05ee6258ac4. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Ochyromera cf. sericea MB-2015" FT /isolate="ARC3518" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738361" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1H9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1H9" FT /protein_id="CUR50157.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 29 C; 40 G; 36 T; 0 other; gggatcacaa agcccgctat tagacgtttg gctaggcgtg gaggagtgaa gcgtatatcg 60 ggattgattt acgaagaaac ccgtggcgtt cttaaagtat ttttagagaa cgttatcaga 120 gatgccgtaa cctacaccga acatgcc 147 // ID LN889327; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889327; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lepidimerodes sp. ARC3520 partial Histone 4 gene for Histone 4, isolate DE ARC3520 XX KW . XX OS Lepidimerodes sp. ARC3520 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Tychiini; Lepidimerodes; unclassified Lepidimerodes. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 21d818bc6fa6e2c6a364966099be2918. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Lepidimerodes sp. ARC3520" FT /isolate="ARC3520" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736978" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1N1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1N1" FT /protein_id="CUR50158.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 31 C; 41 G; 34 T; 0 other; gggatcacta agcccgctat tcgaagattg gctaggcgcg gaggcgtgaa acgtatttcc 60 ggtttgattt acgaggaaac acgcggagtt ctcaaagtgt ttttggaaaa cgtaatcaga 120 gatgccgtga cttacaccga acacgca 147 // ID LN889328; SV 1; linear; genomic DNA; STD; INV; 142 BP. XX AC LN889328; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ipsichora longipes partial Histone 4 gene for Histone 4, isolate ARC3528 XX KW . XX OS Ipsichora longipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Baridinae; Ipsichora. XX RN [1] RP 1-142 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f62522a7271ca73276005a97c173f1d0. XX FH Key Location/Qualifiers FH FT source 1..142 FT /organism="Ipsichora longipes" FT /isolate="ARC3528" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738255" FT CDS <1..>142 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L041" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L041" FT /protein_id="CUR50159.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TE" XX SQ Sequence 142 BP; 39 A; 24 C; 44 G; 35 T; 0 other; gggatcacga aaccggctat tagaagattg gcgagacgtg gtggcgtgaa gcgtatttcg 60 ggcctgattt acgaagaaac gcgtggtgtt ttgaaggtgt ttttggaaaa cgtaatcaga 120 gatgccgtaa cttacaccga ac 142 // ID LN889329; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889329; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Kyklioacalles roboris partial Histone 4 gene for Histone 4, isolate ARC3531 XX KW . XX OS Kyklioacalles roboris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Kyklioacalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; af1410c8fc9f0982c220b3ca2cc0b13d. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Kyklioacalles roboris" FT /isolate="ARC3531" FT /mol_type="genomic DNA" FT /db_xref="taxon:501664" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1H7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1H7" FT /protein_id="CUR50160.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 37 A; 37 C; 46 G; 27 T; 0 other; gggatcacca agcccgccat caggagattg gccagacgcg gaggagtgaa gcgtatttcc 60 ggcttgattt acgaagagac gcgcggagtg ttgaaggtct ttttggaaaa cgtcatccgg 120 gacgccgtaa cgtacaccga acacgcc 147 // ID LN889330; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889330; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles cf. hustachei MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC3532 XX KW . XX OS Acalles cf. hustachei MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4841dd17dea708f09b213df927db12ac. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Acalles cf. hustachei MB-2015" FT /isolate="ARC3532" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738338" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYL0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYL0" FT /protein_id="CUR50161.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 48 A; 32 C; 40 G; 27 T; 0 other; gggatcacga agcccgcaat cagaagactg gccaggcgag gaggcgtgaa acgtatctcg 60 ggattaatat acgaagaaac ccgtggcgtt ctgaaagtat ttttggaaaa cgtaatcaga 120 gatgccgtaa cctataccga acacgca 147 // ID LN889331; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889331; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ithystenus sp. ARC3538 partial Histone 4 gene for Histone 4, isolate DE ARC3538 XX KW . XX OS Ithystenus sp. ARC3538 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Brentidae; OC Trachelizinae; Ithystenus; unclassified Ithystenus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b3fecfc701b665bbca6d1740103c709d. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Ithystenus sp. ARC3538" FT /isolate="ARC3538" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736945" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L5Z6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L5Z6" FT /protein_id="CUR50162.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 29 C; 45 G; 31 T; 0 other; gggatcacca agccggcaat aagacgatta gcgagacgtg gcggtgtcaa gcgtatatct 60 ggcttgattt acgaagaaac gcgtggagtt ttaaaggttt tcttggagaa cgtaataagg 120 gacgcggtca cctacacgga gcacgca 147 // ID LN889332; SV 1; linear; genomic DNA; STD; INV; 146 BP. XX AC LN889332; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Trigonopterus cf. squamosus MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC3664 XX KW . XX OS Trigonopterus cf. squamosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Trigonopterus. XX RN [1] RP 1-146 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 69aaf1510e5ed1d5c455a2f32355e52f. XX FH Key Location/Qualifiers FH FT source 1..146 FT /organism="Trigonopterus cf. squamosus MB-2015" FT /isolate="ARC3664" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738369" FT CDS <1..>146 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYV0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYV0" FT /protein_id="CUR50163.1" FT /translation="GITKPAIRRLARRGGVKXISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 146 BP; 46 A; 30 C; 37 G; 32 T; 1 other; gggatcacta aacccgccat cagaagattg gcccgtcgcg gcggagtaaa asgaatttct 60 ggtctgatat atgaagaaac caggggtgtt ttaaaggtgt ttctagaaaa cgtaataaga 120 gacgccgtta cctacaccga acatgc 146 // ID LN889333; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889333; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3775 partial Histone 4 gene for Histone 4, DE isolate ARC3775 XX KW . XX OS Cryptorhynchini gen. sp. ARC3775 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 22903d18e43d13fbc1ca6a6a307d4960. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchini gen. sp. ARC3775" FT /isolate="ARC3775" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742679" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L464" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L464" FT /protein_id="CUR50164.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 26 C; 42 G; 33 T; 0 other; gggatcacga agccggcaat cagaagattg gctcgacgag gaggtgtaaa acgtatttca 60 gggttgattt acgaagaaac gcgaggtgtt ttgaaagtat tcttggaaaa cgtaatcaga 120 gatgccgtca cttatacgga acacgcc 147 // ID LN889334; SV 1; linear; genomic DNA; STD; INV; 108 BP. XX AC LN889334; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neodecilaus picus partial Histone 4 gene for Histone 4, isolate ARC3780 XX KW . XX OS Neodecilaus picus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Neodecilaus. XX RN [1] RP 1-108 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f4ea45d2386f632b59cb0664514a48dc. XX FH Key Location/Qualifiers FH FT source 1..108 FT /organism="Neodecilaus picus" FT /isolate="ARC3780" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738257" FT CDS <1..>108 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZG2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZG2" FT /protein_id="CUR50165.1" FT /translation="GGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 108 BP; 28 A; 17 C; 31 G; 32 T; 0 other; ggtggagtga agcgtatatc cggtttgatt tatgaagaaa ctcgtggtgt tcttaaagtg 60 tttttggaga atgtgatcag agatgccgta acttacaccg agcacgcc 108 // ID LN889335; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889335; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Gymnoporopterus pictipes partial Histone 4 gene for Histone 4, isolate DE ARC3782 XX KW . XX OS Gymnoporopterus pictipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Gymnoporopterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 99fb5d8ee623f3fbad519d9217a430be. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Gymnoporopterus pictipes" FT /isolate="ARC3782" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738251" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3Q1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3Q1" FT /protein_id="CUR50166.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 28 C; 39 G; 35 T; 0 other; gggatcacca agccagctat tagaagattg gccagacgag gaggcgtaaa acgtatttcc 60 ggtttgattt acgaagaaac ccgtggtgtt ctgaaagtct ttttggaaaa tgtaatcaga 120 gacgccgtga cttatacgga acacgca 147 // ID LN889336; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889336; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dysopirhinus cf grandis MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC3784 XX KW . XX OS Dysopirhinus cf grandis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Dysopirhinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b86aa7fe837d07616c094f38d519b8a5. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Dysopirhinus cf grandis MB-2015" FT /isolate="ARC3784" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738347" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZ44" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ44" FT /protein_id="CUR50167.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 30 C; 41 G; 33 T; 0 other; gggatcacca agcccgcaat tagaagattg gccagacgag gcggagttaa acgtatttcc 60 ggattgattt acgaagagac ccgcggggtt ttaaaggtgt ttttagaaaa cgttatcaga 120 gacgcggtaa cttataccga gcacgcc 147 // ID LN889337; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889337; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pteroporopterus cf. lacunosus MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC3785 XX KW . XX OS Pteroporopterus cf. lacunosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pteroporopterus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4e770728941e412e9acd1b49ccd53ed6. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Pteroporopterus cf. lacunosus MB-2015" FT /isolate="ARC3785" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738365" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1Y2" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Y2" FT /protein_id="CUR50168.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 30 C; 40 G; 33 T; 0 other; gggatcacaa agccagctat tagacgattg gctagacgtg gtggtgttaa acgtatatcc 60 ggattaatat acgaggaaac ccggggcgtt ttgaaagtct tcctggagaa cgtaatcaga 120 gacgctgtaa cgtataccga acacgcc 147 // ID LN889338; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889338; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Hypsophorus dromedarius partial Histone 4 gene for Histone 4, isolate DE ARC3786 XX KW . XX OS Hypsophorus dromedarius OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Hypsophorus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f11342b3c18f3341559dba873baa5c24. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Hypsophorus dromedarius" FT /isolate="ARC3786" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738294" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1E7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1E7" FT /protein_id="CUR50169.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 34 C; 41 G; 29 T; 0 other; gggatcacaa agccggcgat tagaagattg gccagacgag gaggcgtgaa acgtatttcc 60 ggattgattt acgaagaaac ccgcggcgtt ctcaaagtat tcttggaaaa cgttatcagg 120 gacgccgtga cctacaccga acacgct 147 // ID LN889339; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889339; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Salcus elevatus partial Histone 4 gene for Histone 4, isolate ARC3788 XX KW . XX OS Salcus elevatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Salcus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cbfc251ed6e5a755f6d5689cc75f0185. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Salcus elevatus" FT /isolate="ARC3788" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738282" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1J6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1J6" FT /protein_id="CUR50170.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 30 C; 43 G; 33 T; 0 other; gggatcacga agcccgccat cagacgtttg gccagacgag gaggtgtgaa acgtatatcc 60 ggattgatct acgaagaaac ccgtggggta ttgaaagtgt tcttggaaaa cgttatcaga 120 gatgcggtta cctataccga gcatgct 147 // ID LN889340; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889340; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tamphilus amplicollis partial Histone 4 gene for Histone 4, isolate ARC3795 XX KW . XX OS Tamphilus amplicollis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tamphilus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 830ed2749391f542dc947aa4f8802836. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Tamphilus amplicollis" FT /isolate="ARC3795" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738287" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3X7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3X7" FT /protein_id="CUR50171.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 53 A; 23 C; 36 G; 35 T; 0 other; gggatcacta aaccggctat cagaagatta gctagaagag gaggagtaaa acgtatatca 60 ggacttattt acgaagaaac tcgaggagtt ctaaaagttt tcttggaaaa tgtaattagg 120 gacgcagtaa cttataccga gcacgct 147 // ID LN889341; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889341; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Genuacalles sp. ARC3823 partial Histone 4 gene for Histone 4, isolate DE ARC3823 XX KW . XX OS Genuacalles sp. ARC3823 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Genuacalles; unclassified Genuacalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7f2384c6d2cd31e317506c729e37fa37. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Genuacalles sp. ARC3823" FT /isolate="ARC3823" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736970" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYW5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYW5" FT /protein_id="CUR50172.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 49 A; 28 C; 43 G; 27 T; 0 other; gggatcacca agcccgccat cagaagattg gcaagacgtg gaggcgtcaa aagaatatcg 60 ggtctgatat acgaagaaac gagaggggtt ttgaaggtat tcttggaaaa cgtaatcaga 120 gacgccgtta cgtatacgga acacgca 147 // ID LN889342; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889342; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Decilaus sp. ARC3830 partial Histone 4 gene for Histone 4, isolate ARC3830 XX KW . XX OS Decilaus sp. ARC3830 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Decilaus; unclassified Decilaus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 15a95771882b7f7da05d7f72d98d8de8. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Decilaus sp. ARC3830" FT /isolate="ARC3830" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736924" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1J7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1J7" FT /protein_id="CUR50173.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 28 C; 44 G; 35 T; 0 other; gggatcacca agccggctat tagaagatta gccagacgtg gaggggtcaa acgtatttcc 60 gggcttatct atgaggagac tcgtggtgtg cttaaagtat tcttggagaa tgtgatacgc 120 gatgcagtaa catacacgga gcatgcc 147 // ID LN889343; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889343; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Roptoperus sp. ARC3834 partial Histone 4 gene for Histone 4, isolate DE ARC3834 XX KW . XX OS Roptoperus sp. ARC3834 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Roptoperus; unclassified Roptoperus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 411aa9a0db91c5edef968e143e72a665. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Roptoperus sp. ARC3834" FT /isolate="ARC3834" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737038" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1P7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1P7" FT /protein_id="CUR50174.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 38 C; 40 G; 26 T; 0 other; gggatcacca aacccgccat cagaagattg gccaggcgag gaggagtgaa acgtatatcc 60 ggcctgatat acgaggaaac tcgcggcgtt cttaaggtat tcttggaaaa cgtcatcagg 120 gatgccgtaa cctacaccga acacgcc 147 // ID LN889344; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889344; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neomystocis squamiventris partial Histone 4 gene for Histone 4, isolate DE ARC3849 XX KW . XX OS Neomystocis squamiventris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Neomystocis. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bed496eb4271578b9b35eb12e9be457a. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Neomystocis squamiventris" FT /isolate="ARC3849" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738259" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L066" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L066" FT /protein_id="CUR50175.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 28 C; 46 G; 31 T; 0 other; gggatcacca agccggcaat aagacggtta gcgaggcgtg gcggtgtcaa gcgcatatct 60 ggattgattt acgaagaaac gcgtggagtt ttaaaggttt tcttggaaaa cgtgataagg 120 gacgcggtta cctacacgga acacgca 147 // ID LN889345; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889345; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Melanterius aratus partial Histone 4 gene for Histone 4, isolate ARC3853 XX KW . XX OS Melanterius aratus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Melanterius. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 61093b8b38300a6c503b2122821f4373. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Melanterius aratus" FT /isolate="ARC3853" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738316" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1J8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1J8" FT /protein_id="CUR50176.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 30 C; 37 G; 35 T; 0 other; gggatcacca agcccgctat tcgaagattg gccagacgtg gaggtgttaa acgtatctca 60 ggtttaatct acgaagaaac tcgaggcgtt ctcaaagtgt ttttggagaa cgtaatcaga 120 gatgccgtaa cttacacaga acatgca 147 // ID LN889346; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889346; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tyrtaeosus lateralis partial Histone 4 gene for Histone 4, isolate ARC3855 XX KW . XX OS Tyrtaeosus lateralis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tyrtaeosus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cb35176bad81e603234283b372bac740. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Tyrtaeosus lateralis" FT /isolate="ARC3855" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738216" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYM4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYM4" FT /protein_id="CUR50177.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 37 A; 35 C; 38 G; 32 T; 5 other; gggatcacca agcccgccat cagaagattg gctcgacgyg gaggtgtgaa acgtatctcg 60 ggcctcatct acgaagarac cagaggtgtt cttaargttt tcctcgagaa tgtcattagr 120 gaygccgtga cctatactga acatgcc 147 // ID LN889347; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889347; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acrotychreus fasciculatus partial Histone 4 gene for Histone 4, isolate DE ARC3865 XX KW . XX OS Acrotychreus fasciculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acrotychreus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; aab990019e6d98b30431d024660a6c19. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Acrotychreus fasciculatus" FT /isolate="ARC3865" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738220" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L610" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L610" FT /protein_id="CUR50178.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 30 C; 40 G; 32 T; 0 other; gggatcacta agcccgccat aaggagattg gccagacgag gaggtgtgaa acgtatttcc 60 ggtttaattt acgaagaaac gcgcggcgtt ctcaaagtgt ttttggaaaa tgtaataaga 120 gatgccgtca cgtacaccga acacgca 147 // ID LN889348; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889348; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tropidotasia sp. ARC3866 partial Histone 4 gene for Histone 4, isolate DE ARC3866 XX KW . XX OS Tropidotasia sp. ARC3866 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Gasterocercini; Tropidotasia; unclassified Tropidotasia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4c13b45311a11854fa45d32692b3ec7b. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Tropidotasia sp. ARC3866" FT /isolate="ARC3866" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737020" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYV9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYV9" FT /protein_id="CUR50179.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 28 C; 44 G; 32 T; 0 other; gggatcacga aacctgcgat cagaagattg gcgaggcgag ggggtgtaaa gcgtatctcg 60 ggattgatat acgaagaaac tcgtggcgtt ctcaaggtat ttttggaaaa tgtaatcagg 120 gatgccgtaa cctacaccga acatgcc 147 // ID LN889349; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889349; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3869 partial Histone 4 gene for Histone 4, DE isolate ARC3869 XX KW . XX OS Cryptorhynchini gen. sp. ARC3869 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fc7eaa1911141d1616a2bb8515f48a01. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchini gen. sp. ARC3869" FT /isolate="ARC3869" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742680" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L481" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L481" FT /protein_id="CUR50180.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 22 C; 39 G; 41 T; 1 other; gggatcacta aaccggccat tagaagatta gcgagacgtg gtggagttaa gcgtatatct 60 ggtttgattt acgaagaaac tcgtggagtt ttgaaagtgt ttttggaaaa cgtcattaga 120 gatgctgtta catayaccga acatgcc 147 // ID LN889350; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889350; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinidotasia edentata partial Histone 4 gene for Histone 4, isolate ARC3875 XX KW . XX OS Rhinidotasia edentata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Rhinidotasia. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 30cfb113a336f6f423abc29f96c5269a. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Rhinidotasia edentata" FT /isolate="ARC3875" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738280" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZH4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZH4" FT /protein_id="CUR50181.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENGIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 29 C; 42 G; 33 T; 0 other; gggatcacga aaccggcgat cagacggttg gccagacgtg gaggagtgaa gcgtatttcc 60 ggtttaatct atgaagaaac tcgaggagtt ttgaaagtct tcctagaaaa cgggattcgt 120 gatgctgtaa cttacacaga acacgcc 147 // ID LN889351; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889351; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles lemur partial Histone 4 gene for Histone 4, isolate ARC3902 XX KW . XX OS Acalles lemur OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 94f48bee28703a82094a7a18b8ead0eb. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Acalles lemur" FT /isolate="ARC3902" FT /mol_type="genomic DNA" FT /db_xref="taxon:501598" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3R6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3R6" FT /protein_id="CUR50182.1" FT /translation="GITKPXIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 41 A; 34 C; 42 G; 29 T; 1 other; gggatcacca agcccgsgat tagaagactg gccagacgcg gtggcgtaaa acggatatcc 60 ggtttaattt acgaagagac gcgcggagtc ctcaaagtgt ttttggagaa tgtgatcaga 120 gacgccgtta cctataccga acacgcc 147 // ID LN889352; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889352; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhynchaenus fagi partial Histone 4 gene for Histone 4, isolate ARC3904 XX KW . XX OS Rhynchaenus fagi OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Rhynchaeninae; Rhynchaenus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 54e0d22d19190b4a62e040fc9b5c75a5. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Rhynchaenus fagi" FT /isolate="ARC3904" FT /mol_type="genomic DNA" FT /db_xref="taxon:202177" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZ58" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ58" FT /protein_id="CUR50183.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 38 C; 39 G; 26 T; 1 other; gggatcacca agcccgccat aagamgattg gccagacgcg gaggagtcaa acgtatatcc 60 ggtttgatct acgaagaaac tcggggagtc ctgaaagttt tcctggaaaa cgtcatcagg 120 gacgcagtca cctacaccga acacgct 147 // ID LN889353; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889353; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Anthonomus rectirostris partial Histone 4 gene for Histone 4, isolate DE ARC3905 XX KW . XX OS Anthonomus rectirostris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Anthonomini; Anthonomus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bffb30bd6b2e7d32c1cfbc18926330f8. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Anthonomus rectirostris" FT /isolate="ARC3905" FT /mol_type="genomic DNA" FT /db_xref="taxon:1341944" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1Z7" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Z7" FT /protein_id="CUR50184.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 36 A; 35 C; 41 G; 35 T; 0 other; gggatcacca agcccgctat tcgcagattg gccagacgcg gtggtgtcaa gcgtatttcc 60 ggtttgatct acgaagaaac ccgtggagtt ctgaaagtgt tcttggaaaa cgttatcagg 120 gatgcagtca cttacaccga gcatgcc 147 // ID LN889354; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889354; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Curculio glandium partial Histone 4 gene for Histone 4, isolate ARC3907 XX KW . XX OS Curculio glandium OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Curculionini; Curculio. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 80c7300ef24bf29845cac7000a0e9ddd. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Curculio glandium" FT /isolate="ARC3907" FT /mol_type="genomic DNA" FT /db_xref="taxon:197013" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1G3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1G3" FT /protein_id="CUR50185.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 36 C; 45 G; 27 T; 0 other; gggatcacga aacccgccat cagacgtttg gccagacggg gaggcgtgaa acgtatatcc 60 ggcctgatct acgaggagac ccgaggagta ttgaaggttt tcctggaaaa cgtcatcagg 120 gatgcggtta cgtacaccga acatgcc 147 // ID LN889355; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889355; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Magdalis ruficornis partial Histone 4 gene for Histone 4, isolate ARC3908 XX KW . XX OS Magdalis ruficornis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Magdalinae; Magdalis. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0f53a3fa8ce094f91dda8ebec4a2aa2e. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Magdalis ruficornis" FT /isolate="ARC3908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1342046" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1K9" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1K9" FT /protein_id="CUR50186.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 24 C; 47 G; 34 T; 0 other; gggatcacga agccggcgat aagaagattg gctagacgcg gtggagttaa gcgtatatcg 60 ggcttgatat atgaagagac tcgcggggta ttgaaagtgt tcttggaaaa cgttattagg 120 gatgccgtaa cgtataccga acatgcc 147 // ID LN889356; SV 1; linear; genomic DNA; STD; INV; 108 BP. XX AC LN889356; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tychius quinquepunctatus partial Histone 4 gene for Histone 4, isolate DE ARC3914 XX KW . XX OS Tychius quinquepunctatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Tychiinae; Tychius. XX RN [1] RP 1-108 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4c0e12215e2b37849fc5a39846fdcd9f. XX FH Key Location/Qualifiers FH FT source 1..108 FT /organism="Tychius quinquepunctatus" FT /isolate="ARC3914" FT /mol_type="genomic DNA" FT /db_xref="taxon:202191" FT CDS <1..>108 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3Z5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3Z5" FT /protein_id="CUR50187.1" FT /translation="GGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA" XX SQ Sequence 108 BP; 30 A; 19 C; 26 G; 25 T; 8 other; ggyggcgtca aacgtatatc cggtttgatt tacgaagaaa cyagaggrgt tctwaaagtr 60 tttttggaaa acgtwattcg agaygccgtg acttayaccg aacacgcc 108 // ID LN889357; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889357; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinusa tetra partial Histone 4 gene for Histone 4, isolate ARC3917 XX KW . XX OS Rhinusa tetra OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Mecinini; Rhinusa. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d9d2b9f7fe64284f73777c42495d25a8. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Rhinusa tetra" FT /isolate="ARC3917" FT /mol_type="genomic DNA" FT /db_xref="taxon:526605" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYY3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYY3" FT /protein_id="CUR50188.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 33 C; 41 G; 28 T; 0 other; gggatcacga agcccgcgat cagaagatta gccaggcgcg gaggagtaaa acgtatttcg 60 ggtctaattt acgaagaaac gcgaggcgtt ctcaaagtat ttttggaaaa tgtaatcagg 120 gacgccgtga cctacaccga acacgcc 147 // ID LN889358; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889358; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Larinus turbinatus partial Histone 4 gene for Histone 4, isolate ARC3919 XX KW . XX OS Larinus turbinatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cleoninae; Larinus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5df98f47a0028a1fe1d1486f6b31f3b9. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Larinus turbinatus" FT /isolate="ARC3919" FT /mol_type="genomic DNA" FT /db_xref="taxon:202011" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1K8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1K8" FT /protein_id="CUR50189.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 48 A; 34 C; 36 G; 29 T; 0 other; gggatcacca agcccgcaat cagaagattg gccagacgcg gaggagttaa acgtatttcc 60 ggtcttatct acgaagaaac gcggggagtt ctaaaagtat ttttagaaaa cgtaatcaga 120 gacgccgtaa cctacaccga acacgct 147 // ID LN889359; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889359; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cionus thapsus partial Histone 4 gene for Histone 4, isolate ARC3920 XX KW . XX OS Cionus thapsus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cioninae; Cionus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fa8c329bc2a450819d5aaebae3ba67f4. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cionus thapsus" FT /isolate="ARC3920" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738164" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1R1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1R1" FT /protein_id="CUR50190.1" FT /translation="GITKPAIRXLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 33 C; 40 G; 30 T; 4 other; gggatcacta aaccggctat cagaagkttr gccaggcgcg gtggygtgaa acgtatttcc 60 ggyttaattt acgaagaaac gcgcggggtc ctaaaagtat ttttggaaaa cgtcatcagg 120 gacgccgtga cttacaccga acacgcc 147 // ID LN889360; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889360; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhinoncus castor partial Histone 4 gene for Histone 4, isolate ARC3921 XX KW . XX OS Rhinoncus castor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Ceutorhynchinae; Rhinoncus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ba1b5208109bc9d0886ae34837890950. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Rhinoncus castor" FT /isolate="ARC3921" FT /mol_type="genomic DNA" FT /db_xref="taxon:878412" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L078" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L078" FT /protein_id="CUR50191.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 34 C; 42 G; 29 T; 0 other; gggatcacca agcccgccat cagaagattg gccagacgcg gaggagtaaa acgtatttcg 60 gggttgatct acgaagaaac ccgcggcgtt ttaaaagttt tcttggagaa cgtgatcagg 120 gacgccgtaa cgtataccga acacgct 147 // ID LN889361; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889361; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Bothynoderes sp. ARC3928 partial Histone 4 gene for Histone 4, isolate DE ARC3928 XX KW . XX OS Bothynoderes sp. ARC3928 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Lixinae; Bothynoderes; unclassified Bothynoderes. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bd8e3fcbebfac43f83d91d9f9dc3aaf2. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Bothynoderes sp. ARC3928" FT /isolate="ARC3928" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736920" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1L0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1L0" FT /protein_id="CUR50192.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 31 C; 44 G; 33 T; 0 other; gggatcacca agccggctat caggagattg gccagacgtg ggggggttaa gcgtatttcg 60 ggattgatat acgaggaaac acgtggcgtt ctcaaagtgt ttttagaaaa cgtcattcga 120 gatgccgtaa cctacaccga gcacgct 147 // ID LN889362; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889362; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Phalias sp. ARC3953 partial Histone 4 gene for Histone 4, isolate ARC3953 XX KW . XX OS Phalias sp. ARC3953 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Phalias; unclassified Phalias. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9e76e928e5e03f5ed011ba80cc03accf. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Phalias sp. ARC3953" FT /isolate="ARC3953" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736990" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYN8" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYN8" FT /protein_id="CUR50193.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 46 A; 31 C; 42 G; 28 T; 0 other; gggatcacta aaccggcgat cagaaggttg gccagacgag gaggagtcaa gagaatatcc 60 ggactgattt acgaagaaac tcgaggcgtc ctcaaagtat ttttggaaaa cgtgatcagg 120 gacgccgtta cctatacgga acacgct 147 // ID LN889363; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889363; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Metoposoma cf. funebris MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC3956 XX KW . XX OS Metoposoma cf. funebris MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Metoposoma. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4985f42386703939ed8a612005c2b933. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Metoposoma cf. funebris MB-2015" FT /isolate="ARC3956" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738352" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L627" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L627" FT /protein_id="CUR50194.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 30 C; 41 G; 29 T; 3 other; gggatcacca aaccagctat cagaaggtta gccagacgmg gcggggtcaa acgaatatcc 60 ggtttgattt acgaagaaac scgcggagtt ttaaaagtgt tyttggaaaa cgtcattagg 120 gacgcggtta cctacacgga acacgcg 147 // ID LN889364; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889364; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulus sp. ARC3957 partial Histone 4 gene for Histone 4, isolate ARC3957 XX KW . XX OS Eubulus sp. ARC3957 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulus; unclassified Eubulus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4fb1844559c00e591f24d1a335c9e7e1. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Eubulus sp. ARC3957" FT /isolate="ARC3957" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736927" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYY4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYY4" FT /protein_id="CUR50195.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 42 A; 28 C; 44 G; 33 T; 0 other; gggatcacca aaccggctat cagaagattg gccagacgcg gcggtgtcaa acgtatatcg 60 ggtttgattt atgaagaaac gcggggagtt ttgaaggtgt tcttggaaaa tgtcatcaga 120 gatgcggtta cctacacgga acacgca 147 // ID LN889365; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889365; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3958 partial Histone 4 gene for Histone 4, DE isolate ARC3958 XX KW . XX OS Cryptorhynchini gen. sp. ARC3958 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f773ab5124e71ca091044c1d2c6eb915. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchini gen. sp. ARC3958" FT /isolate="ARC3958" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742681" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L4A0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4A0" FT /protein_id="CUR50196.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 34 C; 40 G; 33 T; 0 other; gggatcacga aacccgccat aagaagattg gctcgccgtg gcggtgtgaa acgtatttct 60 ggattgatct acgaagaaac cagaggtgtc cttaaggtgt tcctcgaaaa tgtcatcaga 120 gatgccgtca cctatacgga gcacgct 147 // ID LN889366; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889366; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC3960 partial Histone 4 gene for Histone 4, DE isolate ARC3960 XX KW . XX OS Cryptorhynchini gen. sp. ARC3960 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fdf745a3e7657af1bd9ec0556891e690. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchini gen. sp. ARC3960" FT /isolate="ARC3960" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742682" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZJ1" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZJ1" FT /protein_id="CUR50197.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 37 A; 36 C; 45 G; 29 T; 0 other; gggatcacca agcccgccat caggaggttg gccaggcgtg gcggagtgaa acgtatttcc 60 ggtttgatct atgaggaaac ccgtggagtg ctaaaagtgt tcttggaaaa cgtgatcagg 120 gacgccgtca cttacaccga acacgcc 147 // ID LN889367; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889367; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Conotrachelus sp. 3. group 4. subgroup partial Histone 4 gene for Histone DE 4, isolate ARC3961 XX KW . XX OS Conotrachelus sp. group 3 subgroup 4 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Conotrachelus; unclassified Conotrachelus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 083293106e4b8ced9f46ccbb96474878. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Conotrachelus sp. group 3 subgroup 4 MB-2015" FT /isolate="ARC3961" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742689" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L3T0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3T0" FT /protein_id="CUR50198.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 30 C; 44 G; 29 T; 0 other; gggatcacca agccggctat cagaagattg gccagacgcg gcggtgtcaa acgaatatca 60 ggtctgatat atgaagaaac gcggggtgtc ttgaaggtgt tcttagaaaa cgtcatcagg 120 gacgcagtta cgtatacgga acacgca 147 // ID LN889368; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889368; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cophes sp. ARC3962 partial Histone 4 gene for Histone 4, isolate ARC3962 XX KW . XX OS Cophes sp. ARC3962 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cophes; unclassified Cophes. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8cb9f5a43b79b63ed7621486cf5d9906. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cophes sp. ARC3962" FT /isolate="ARC3962" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736960" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KZ71" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ71" FT /protein_id="CUR50199.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 32 C; 42 G; 34 T; 0 other; gggatcacga agcccgctat tagaagattg gctagacgtg gaggtgtaaa acgtatttcc 60 ggtctcatct acgaagagac tcgcggagtc cttaaagtct tcctggagaa cgtgatacgg 120 gatgcggtaa cttacactga gcacgct 147 // ID LN889369; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889369; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus albopunctatus partial Histone 4 gene for Histone 4, isolate DE ARC3963 XX KW . XX OS Cryptorhynchus albopunctatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 263135b5c5f6476b8d7b08ac7e1d0fbb. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Cryptorhynchus albopunctatus" FT /isolate="ARC3963" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738167" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L212" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L212" FT /protein_id="CUR50200.1" FT /translation="GITKPAIRRLARRGGVKXISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 39 A; 30 C; 38 G; 28 T; 12 other; gggatcacka arccsgctat cagaagattg gccagacggg gaggcgtaaa amgtatttcc 60 gggctmatct acgaagarac ccgrggcgtt cttaaggtst ttttggaaaa tgtgatcaga 120 gaygccgtma cwtacaccga acacgcy 147 // ID LN889370; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889370; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Phyrdenus sp. ARC3968 partial Histone 4 gene for Histone 4, isolate ARC3968 XX KW . XX OS Phyrdenus sp. ARC3968 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Phyrdenus; unclassified Phyrdenus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8b1d96dee67c7c0aa457003bcfc76bbf. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Phyrdenus sp. ARC3968" FT /isolate="ARC3968" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736992" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1I0" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1I0" FT /protein_id="CUR50201.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 33 C; 41 G; 33 T; 0 other; gggatcacga agcccgccat taggaggttg gccagacgcg gtggagtcaa acgtatatct 60 ggtttgattt atgaagaaac tcgtggcgta ctcaaagtgt ttttggaaaa cgtaatcagg 120 gatgccgtca cctacaccga acacgcc 147 // ID LN889371; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889371; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Conotrachelus sp. group 4 MB-2015 partial Histone 4 gene for Histone 4, DE isolate ARC3969 XX KW . XX OS Conotrachelus sp. group 4 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Conotrachelus; unclassified Conotrachelus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 532b7a6c02b96b95c437814c4339dc73. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Conotrachelus sp. group 4 MB-2015" FT /isolate="ARC3969" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742690" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1M3" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1M3" FT /protein_id="CUR50202.1" FT /translation="GITXPAIRRLARRGGVKXISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 28 C; 37 G; 31 T; 7 other; gggatcacsa rgcccgccat magaagattg gccagacgag gtggwgtaaa gsgtatctcc 60 ggtttaatat aygaagaaac ccgtggcgta ttgaaagttt tcttggaaaa cgtaatyaga 120 gacgctgtta catataccga acacgcc 147 // ID LN889372; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889372; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Zascelis cf. irrorata MB-2015 partial Histone 4 gene for Histone 4, isolate DE ARC3980 XX KW . XX OS Zascelis cf. irrorata MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Zascelis. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d42b9d4c1b8801ba0f3f6175bf8ce23a. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Zascelis cf. irrorata MB-2015" FT /isolate="ARC3980" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738371" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L410" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L410" FT /protein_id="CUR50203.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 49 A; 30 C; 40 G; 26 T; 2 other; gggatcacga aaccagcaat ycgaaggctg gctagacgag gaggagtaaa acgtatatcs 60 ggattgatat acgaagaaac tcgaggcgtc ctcaaggtat ttctggaaaa cgtaatcagg 120 gacgcagtca cctatacgga acacgct 147 // ID LN889373; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889373; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Conotrachelus sp. ARC3981 partial Histone 4 gene for Histone 4, isolate DE ARC3981 XX KW . XX OS Conotrachelus sp. ARC3981 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Conotrachelus; unclassified Conotrachelus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f781b66106fa3e7bfb6fd25ed1a20aef. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Conotrachelus sp. ARC3981" FT /isolate="ARC3981" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736922" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4KYZ6" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYZ6" FT /protein_id="CUR50204.1" FT /translation="GITKPAIRRXARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 44 A; 27 C; 42 G; 32 T; 2 other; gggatcacsa aaccggccat tagaagatkg gctagacgag gcggtgttaa gcgtatatcc 60 ggcttgattt acgaagagac acgtggagtt ttaaaagtat ttttggagaa cgtaatcagg 120 gacgcagtta cctacacgga gcacgca 147 // ID LN889374; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889374; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acallocrates denticollis partial Histone 4 gene for Histone 4, isolate DE ZFMK-DNA-0100405065 XX KW . XX OS Acallocrates denticollis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acallocrates. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 99fc0e4424058a3ba7615f7b807cd67c. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Acallocrates denticollis" FT /isolate="ZFMK-DNA-0100405065" FT /mol_type="genomic DNA" FT /db_xref="taxon:501629" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1M4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1M4" FT /protein_id="CUR50205.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 40 A; 35 C; 38 G; 30 T; 4 other; gggatcacca arccagcaat cagacgattg gccagacgtg gyggcgtcaa acgtatttcg 60 ggtttratct acgaagaaac ccgtggtgta ctcaaagtgt ttttggaaaa cgtratccga 120 gacgcggtta cgtacaccga acacgcc 147 // ID LN889375; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889375; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Torneuma deplanatum partial Histone 4 gene for Histone 4, isolate DE ZFMK-DNA-0100400462 XX KW . XX OS Torneuma deplanatum OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Torneuma; Typhloporus. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bddc49ae80d4e79ddc4ef210cd9f8247. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Torneuma deplanatum" FT /isolate="ZFMK-DNA-0100400462" FT /mol_type="genomic DNA" FT /db_xref="taxon:501687" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L1S5" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1S5" FT /protein_id="CUR50206.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 43 A; 30 C; 39 G; 35 T; 0 other; gggatcacga agcccgctat tagaagatta gccagacgag gaggtgttaa acgtatttct 60 ggtctaatct acgaggaaac ccgtggagta cttaaagtat ttctggaaaa tgtgatcagg 120 gatgccgtta cttacaccga gcacgcc 147 // ID LN889376; SV 1; linear; genomic DNA; STD; INV; 147 BP. XX AC LN889376; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Onyxacalles vilae partial Histone 4 gene for Histone 4, isolate DE ZFMK-DNA-0100400750 XX KW . XX OS Onyxacalles vilae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Onyxacalles. XX RN [1] RP 1-147 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 82ce5964019d2b1bddafe3592ea38bfc. XX FH Key Location/Qualifiers FH FT source 1..147 FT /organism="Onyxacalles vilae" FT /isolate="ZFMK-DNA-0100400750" FT /mol_type="genomic DNA" FT /db_xref="taxon:1342064" FT CDS <1..>147 FT /codon_start=1 FT /transl_table=1 FT /gene="Histone 4" FT /product="Histone 4" FT /db_xref="GOA:A0A0S4L089" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L089" FT /protein_id="CUR50207.1" FT /translation="GITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY FT TEHA" XX SQ Sequence 147 BP; 45 A; 27 C; 46 G; 29 T; 0 other; gggatcacga aaccggctat cagaaggtta gccagacgcg gaggagttaa acggatatcg 60 ggtctgatat atgaagaaac gcggggagtt ttgaaggtgt tcctggaaaa cgtaattagg 120 gacgccgtca cttatacgga acacgca 147 // ID LN889377; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889377; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mecopus bispinosus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0317 XX KW . XX OS Mecopus bispinosus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Mecopus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6b341f8fa5678cdc03af18b5c5c49795. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Mecopus bispinosus" FT /organelle="mitochondrion" FT /isolate="ARC0317" FT /mol_type="genomic DNA" FT /db_xref="taxon:1117731" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1M5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1M5" FT /protein_id="CUR50208.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIINKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSILGAINFISTIINMRSKGMKPEQMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 111 C; 78 G; 206 T; 0 other; atagtcggca cttctttaag aatactaatt cgcactgaat taggtaatcc cggaagatta 60 attggaaatg accaaatcta taattcaatt gtaactgctc atgcctttat tataattttc 120 tttatagtaa taccaattat aattggagga tttggtaatt gactaattcc cctcatatta 180 ggggcccctg atatagcctt tccacgtctt aacaatataa gattttgact cttaccccct 240 tctttaacac ttcttttaat aagaagaatt attaataaag gagcaggtac cggctgaact 300 gtttatcctc ctttatcttc aaatattgca catgaaggag cctcagttga tttagccatt 360 tttaggctcc atatagccgg aatttcatct attttagggg caattaattt tatctcaact 420 attattaata tacgatccaa aggaataaaa cctgaacaaa taccattatt tatctgagca 480 gtaaaaatta ccgccatcct tttacttctt tcattaccgg ttttagcagg tgctatcacc 540 atacttttaa cagatcgaaa tattaataca tcttttt 577 // ID LN889378; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889378; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0601 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC0601 XX KW . XX OS Cryptorhynchini gen. sp. ARC0601 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b500096dc4b8850887e82676a69d3538. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchini gen. sp. ARC0601" FT /organelle="mitochondrion" FT /isolate="ARC0601" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742674" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KYQ5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYQ5" FT /protein_id="CUR50209.1" FT /translation="MVGTSLSMLIRTELGTPGMLIGNNQIYNSMVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLMTSSIISNGAGTGWTVYPP FT LSANIAHEGPSVDLAIFSLHLAGMSSILGAMNFISTINNMRPTGMNLDQVSLLTWAVNI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 184 A; 114 C; 79 G; 200 T; 0 other; atagtcggaa cctcattaag aatattaatt cgaacagaat tagggactcc cggaatacta 60 atcggaaaca atcaaattta taattctata gtaacagctc acgctttcat tataattttt 120 tttatagtaa taccaattat aattggtggt tttggtaatt gacttattcc attaatacta 180 ggagccccag atatagcctt cccacgcctt aataatataa gattttgatt attaccacca 240 tcccttactc ttcttataac aagaagaatt attagaaatg gagcaggaac aggttgaaca 300 gtttatcccc ctttgtctgc caatattgcc catgaaggcc catctgtaga cttagcgatt 360 tttagattac acctagctgg catatcatca attttaggag ctataaattt catctctact 420 attaataata tacgtcccac aggtataaac ttagatcaag tgtccttact aacttgagct 480 gtaaatatta cagctatttt acttctttta tctttacctg ttcttgcagg ggcaatcaca 540 atacttctca cagatcgtaa tattaataca tcctttt 577 // ID LN889379; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889379; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pseudoporopterus sp. ARC0884 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC0884 XX KW . XX OS Pseudoporopterus sp. ARC0884 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pseudoporopterus; unclassified Pseudoporopterus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c02378683a6d0cf44651eeaf85f50563. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Pseudoporopterus sp. ARC0884" FT /organelle="mitochondrion" FT /isolate="ARC0884" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737006" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L645" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L645" FT /protein_id="CUR50210.1" FT /translation="MTGTSXSVLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRXNNMSFWLLPPSLTLLLTSSIFDSGTGTGWTVYPP FT LXXNIAHEGASIDLAIFSLHMAGMSSILGAMNFIXTITNMRPKGMKSERMPLFVWAVKI FT TAILLLISXPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 173 A; 106 C; 79 G; 211 T; 8 other; ataactggaa cttctyttag agtattaatt cgaactgaac taggaaaccc aggtactttg 60 attggaaatg atcaaattta taattccatt gtcacagctc acgctttcat tataattttt 120 tttatagtta taccaattat aattggtgga tttggaaact gattagttcc ccttatatta 180 ggtgccccag atatagcctt tccacgtytt aataatataa gattttgact tytaccacct 240 tccttaaccc ttcttttaac aagaagaatt tttgataggg gaactggaac aggatgaaca 300 gtctatccac ctttatytty taatattgcc cacgaaggag catctattga tctagcaatt 360 tttagccttc atatagcagg tatatcatct atyttagggg caataaactt catttytact 420 attactaata tacgccctaa aggtataaaa tccgaacgta tacctctttt cgtttgagca 480 gttaaaatta ctgctatttt acttttaatt tctyttccag ttcttgccgg agctattact 540 atacttttaa cagatcgaaa tattaacacc tcctttt 577 // ID LN889380; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889380; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0886 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC0886 XX KW . XX OS Cryptorhynchini gen. sp. ARC0886 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 04255e9486e28e64a3bad37c33294c95. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchini gen. sp. ARC0886" FT /organelle="mitochondrion" FT /isolate="ARC0886" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742675" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ17" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ17" FT /protein_id="CUR50211.1" FT /translation="MAGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNXMSFWLXPPSLTLLIMSSIIDKGAGTGWTVYPP FT LSTNIAHEGVSVDLAIFSLHMAGISSILGAMNFISTVINMHPMGMTPERLSLFVWAVQI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 175 A; 114 C; 86 G; 199 T; 3 other; atagcaggaa cctctttaag aatactaatt cggactgaac taggaacccc tgggactcta 60 attggaaacg accaaattta caatagtatt gttacagccc atgcatttat tataattttt 120 tttatagtta tacctattat aattggggga ttcggaaatt gattagttcc tttaatatta 180 ggagccccag atatggcatt ccctcgatta aataawataa gattctggct tyttccccca 240 tcccttactt tattaatcat aagaagaatt attgacaaag gagcaggcac aggttgaaca 300 gtataccccc ctttatcaac aaacattgcc catgagggag tatctgttga tttagcaatt 360 tttagactcc atatagcagg tatttcctct atyttaggag caataaattt tatttctact 420 gttattaata tacaccccat aggaataacc cctgaacgcc tctcattatt cgtatgagct 480 gtacaaatca ctgctatttt attactttta tcattgcccg ttttagccgg ggctatcact 540 atacttttaa ctgatcgtaa tatcaataca tcttttt 577 // ID LN889381; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889381; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acalles sp. ARC0888 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0888 XX KW . XX OS Acalles sp. ARC0888 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acalles; unclassified Acalles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 82b75622638bd155d5965e6c58270c6f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Acalles sp. ARC0888" FT /organelle="mitochondrion" FT /isolate="ARC0888" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736914" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4D4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4D4" FT /protein_id="CUR50212.1" FT /translation="MIGTSLSVLIRSELGISGTLIGNDQIYNTIVTAHAFIMIFFMVMP FT MMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLILLLSSSIIDKGAGTGWTVYPP FT LSMNSTHSGPSVDLTIFSLHMAGISSILGAMNFISTVANMRPEGMTLDRMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 181 A; 93 C; 83 G; 220 T; 0 other; ataattggaa cctctttaag ggtattaatc cgatcagaac ttgggatttc tggtacatta 60 attggtaacg accaaattta taatacaatt gtaacagctc atgcttttat tataattttt 120 tttatagtta tacctataat aattggtggt tttggaaatt gattagttcc tttaatatta 180 ggggctcctg atatagcttt cccacgatta aataatataa gattttgact tcttccccca 240 tctttgattc ttctattatc aagaagaatt attgacaaag gagcagggac tggttgaaca 300 gtttatcctc ctttatcgat aaactcaaca catagaggcc catcagtaga tttaactatt 360 tttagtcttc atatagcagg aatttcctct atcttaggag ctataaattt tatttcaaca 420 gtagctaata tacgacctga aggaataact cttgatcgta tacctctctt tgtatgagct 480 gtaaaaatta cagcaatttt acttttatta tctttaccag ttttagcagg agcaattact 540 atattattaa ctgatcgaaa tattaataca tcttttt 577 // ID LN889382; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889382; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ptolycus sp. ARC0890 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0890 XX KW . XX OS Ptolycus sp. ARC0890 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ptolycus; unclassified Ptolycus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f16bfbd9e5b4d4b1c7e1ac4108c9c10f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ptolycus sp. ARC0890" FT /organelle="mitochondrion" FT /isolate="ARC0890" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737008" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZM3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZM3" FT /protein_id="CUR50213.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLXMSXIIDKGAGTGWTVYPP FT LSSNVAHEGASVDLAIFSLHMAGISXILGAMNFISTVINMRPMGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 109 C; 79 G; 207 T; 3 other; atagtaggaa catctttaag tatattaatt cgaactgaat tgggtaatcc cggtacccta 60 attggaaatg accaaatcta taactccatt gtaacagctc atgcttttat tataatcttc 120 tttatagtta taccaattat aattggagga ttcggaaatt gattaattcc tttaatactc 180 ggagctcctg atatggcatt ccctcgactt aacaatataa gattttgact tttacctcct 240 tctttaactc ttcttyttat aagaaraatt attgataaag gagcaggtac aggatgaact 300 gtttaccccc cattatcctc aaatgtagcc cacgaaggag catctgttga cttagcaatt 360 tttagtcttc atatagcagg aatttcatyt attttaggag ccataaattt tatttccaca 420 gtaatcaata tacgaccaat aggaataaac ccagaccgta tacctctctt tatctgagca 480 gtcaaaatta cagctattct tttacttctt tcattaccag ttcttgcagg agcaattact 540 atattattga ctgatcgtaa tattaatact tcttttt 577 // ID LN889383; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889383; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nechyrus cf. puncticollis MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC0892 XX KW . XX OS Nechyrus cf. puncticollis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nechyrus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3db68473c3c282de54a84c5cd7e6950a. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Nechyrus cf. puncticollis MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC0892" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738358" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L3V5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3V5" FT /protein_id="CUR50214.1" FT /translation="MVGTSMSMLIXTEXGNPGTLIGNDQIYXSIVTAHXFIMIFFMVMP FT IMIGGFGNWLVPLLLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGMXSILGAMNFISTVINMRPTGMKPDRMPLFVWAVKI FT TXILLXLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 174 A; 124 C; 85 G; 184 T; 10 other; atagtaggaa catctataag aatattaatt ygtaccgaaw taggaaaccc mggaaccctt 60 attggaaatg accaaattta taawtcaatt gtaactgccc atgstttcat tataatyttc 120 tttatagtta taccaatcat aattggtgga ttcggtaatt gattagttcc tctattacta 180 ggagccccag acatagcctt cccccgactt aataatataa gtttytgact cttgccccca 240 tccctaaccc ttttattaat aagaagaatc attgataaag gagcggggac gggttgaact 300 gtataccccc cattatcttc aaacgtagcc catgaaggaa tttctgtaga ccttgctatt 360 tttagactac atatagctgg aatatyttcc attctaggag caataaactt catttcaacc 420 gttattaaca tgcgacccac aggaataaag cctgatcgca tacctctttt tgtgtgagcc 480 gtaaaaatta cawcaattct ccttyttcta tcactaccag ttttggcagg cgccatcacc 540 atacttctca ctgatcgtaa tattaatact tcatttt 577 // ID LN889384; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889384; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nechyrus cf. porcatus MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC0893 XX KW . XX OS Nechyrus cf. porcatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nechyrus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e08ff725f741de92a4467f729f7bc9b4. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Nechyrus cf. porcatus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC0893" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738357" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ99" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ99" FT /protein_id="CUR50215.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQTYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGMSSILGAMNFISSVINMRPEGMKPDRMPLFMWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 140 C; 84 G; 171 T; 0 other; atagtaggaa cctctctaag aatattaatt cgcaccgaac taggaaaccc aggcacatta 60 atcggaaatg accaaaccta taactccatt gtaactgctc acgcgttcat tataattttc 120 ttcatagtta taccaattat aattggagga tttggaaact gactaattcc acttatgctg 180 ggggccccag acatagcatt ccctcgactc aataatataa gattttgact cctgccacca 240 tcattaactc ttcttcttat aagaagaatt attgataaag gagctgggac aggatgaacc 300 gtctacccac cactatcatc aaatgtagcc cacgaaggaa tttccgtaga tctcgccatt 360 tttagtctac acatagctgg aatatcatct attctcggag ccataaactt tatctcctca 420 gtaatcaaca tacgacctga aggaataaaa cctgatcgaa tacctttatt tatatgagct 480 gtaaaaatta ctgcaattct tctactcctc tccttgcctg ttctcgcagg agctatcaca 540 atactattaa ctgaccgcaa catcaacact tcctttt 577 // ID LN889385; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889385; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Asytesta sp. cf. albifrons MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC0897 XX KW . XX OS Asytesta cf. albifrons MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Asytesta. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; faae8fb4d868d58dc16cb5b725980683. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Asytesta cf. albifrons MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC0897" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738341" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L241" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L241" FT /protein_id="CUR50216.1" FT /translation="MVGTSLSVLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSNYIDNGTGTGWTVYPP FT LSSNIAHEGFSVDLAIFSLHMAGVSSILGAMNFISTIMNMRPKGMDLDRMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 175 A; 125 C; 85 G; 192 T; 0 other; atagtcggaa cttctttaag agtcctgatt cgcacagaat taggaaaccc aggaacccta 60 atcggaaatg accaaatcta taactctatt gttacagccc atgcttttat tataattttc 120 tttatagtaa taccaattat aattggagga tttggaaatt ggcttgttcc gctaatatta 180 ggagcccctg atatggcttt cccccgccta aataatataa gattctggct gcttccccct 240 tcattaaccc ttcttttaat aagaaattat attgataacg gtacaggaac cggatgaact 300 gtttaccccc ctttaagatc aaatatcgcc catgaaggct tctcagttga tttagccatt 360 tttagtttac acatagcagg tgtatcttca attctaggag caataaattt tatctctaca 420 atcataaata tacgacctaa aggaatagat ttagatcgta taccactttt tgtttgagca 480 gttaaaatta ctgctatctt actacttcta tccctcccag ttctggcagg agcaattacc 540 atacttttaa ctgaccgaaa cattaacacc tccttct 577 // ID LN889386; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889386; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nyphaeba sp. ARC0899 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0899 XX KW . XX OS Nyphaeba sp. ARC0899 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nyphaeba; unclassified Nyphaeba. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 68d838f4c86bff6cd454253abf8045c3. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Nyphaeba sp. ARC0899" FT /organelle="mitochondrion" FT /isolate="ARC0899" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736986" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1L2" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1L2" FT /protein_id="CUR50217.1" FT /translation="MIGSSLSIIIRAELSNLGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSANIAHEGASVDLAIFSLHMAGIXSILGAINFIXTIMNMRPKGMSLDRLPLFVWAVKX FT TAIXXXLSXPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 171 A; 101 C; 85 G; 211 T; 9 other; ataattggat cctcattaag aattattatt cgagctgaac taaggaattt aggatcttta 60 attggtaatg atcaaattta taattcaatt gtcacagctc atgcctttat cataattttt 120 tttatagtta taccaattat aattggggga ttcggaaatt ggctagtacc tttaatatta 180 ggagcccctg atatagcttt cccacgatta aataatataa gtttytgact tttacctccc 240 tctttaacct tactattaat aagaagaatt attgataaag gggcagggac aggttgaaca 300 gtttaccccc ctctatcagc taatattgcc cacgaaggag cttctgtaga tttagctatc 360 tttagtctac atatggcagg aatctyttct atccttgggg ctattaattt tatctytact 420 attataaata tacgccctaa aggcatatca ttagaccgct tacctttatt tgtttgagca 480 gtaaaaawta ctgcaattyt tyttyttctt tctyttcctg tyttagccgg agcaatcact 540 atactactga cagatcgtaa tattaataca tcattct 577 // ID LN889387; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889387; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantiala illusa mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0900 XX KW . XX OS Pantiala illusa OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pantiala. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 00dd7323fe96f32846e0044e6f7ff255. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Pantiala illusa" FT /organelle="mitochondrion" FT /isolate="ARC0900" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738267" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1P8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1P8" FT /protein_id="CUR50218.1" FT /translation="MVGTSMSMXIRTELGTPGMLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNXMSFWLLPPSLXXLLMSSITDKGAGTGWTVYPP FT XSSNLAHEGAAIDLAIFSLHMAGIXXILGAINFIXTVMNMRPAGMKLDQMTLFTWSVKI FT TAIXLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 95 C; 84 G; 204 T; 12 other; atagtcggaa catctataag aatahtaatt cgtacagaat tagggactcc cggcatatta 60 attggtaatg accaaattta taattctatt gtaacagctc atgcttttat tataatyttt 120 tttatagtta tgccaattat aattggagga ttcggaaatt gactagtccc attaatactc 180 ggagctcctg atatagcttt tcctcgactc aacaawataa gattttgact tttaccccct 240 tctctatyty ttttactaat aagaagaatt acagataaag gtgcggggac tgggtgaaca 300 gtttaccccc cccyatcttc taatttagcc catgaaggag ctgctattga tttagctatt 360 tttaggcttc atatagcagg aatytyttyt attytaggag caattaactt tatttytaca 420 gtaataaata tacgacctgc aggtataaaa cttgatcaaa taacgttatt tacttgatca 480 gtaaaaatta cagctattyt tcttttatta agattacctg tacttgcagg agcaattact 540 atactactta cagatcgaaa tattaatact tcatttt 577 // ID LN889388; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889388; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Asytesta cf. rata MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC0901 XX KW . XX OS Asytesta cf. rata MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Asytesta. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3272241ab199fecad318f395d3d9e51b. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Asytesta cf. rata MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC0901" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738340" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L453" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L453" FT /protein_id="CUR50219.1" FT /translation="MVGTSMSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLXLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGVXSILGAMNFISTVMNMRPKGMSLDRMPLFVWAVKI FT TAILLLLSXPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 174 A; 119 C; 87 G; 189 T; 8 other; atagtaggaa cctctataag aatattaatc cgaacagagc taggaaatcc cggcacctta 60 atcggaaatg accaaatcta taactccatt gtcactgccc atgcctttat tataattttc 120 tttatagtga taccaattat aattggaggg tttggaaact gattagtacc cctcatatta 180 ggagctcctg atatagcatt tccccgactt aataatataa gattctggct cctacctcca 240 tcgctaaccc ttyttytgat aagaagaatt attgacaaag gagcaggaac aggttgaact 300 gtttatcccc cyttaagatc aaatattgct catgaaggta tctctgtcga cttagctatt 360 tttagtttac acatagcagg tgtctyttct atcctaggag ctataaattt catttcaaca 420 gtcataaata tacgtccaaa aggaataagc cttgatcgaa tacctctytt ygtytgagct 480 gttaaaatca cagccatttt attactcctt tctyttccgg ttcttgctgg agcaatcaca 540 atactactta cagaccgtaa tattaatact tcttttt 577 // ID LN889389; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889389; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Doetes sp. ARC0906 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0906 XX KW . XX OS Doetes sp. ARC0906 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Doetes; unclassified Doetes. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2c99ffe2f95fdd606de57b76b97885ec. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Doetes sp. ARC0906" FT /organelle="mitochondrion" FT /isolate="ARC0906" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736964" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ23" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ23" FT /protein_id="CUR50220.1" FT /translation="TIGTSMSIIIRTELGNPGPLIGNDQLYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMGSIVGKGAGTGWTVYPP FT LASSTAHEGASVDLAIFSLHMAGISSILGAINFISTVANMRPTGMNLEQMPLFSWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 176 A; 131 C; 91 G; 179 T; 0 other; acaatcggaa cttcaataag aattattatt cgaactgaat tagggaatcc tggcccccta 60 attggaaatg atcagctata taactctatc gtcacagcac atgcctttat tataattttt 120 tttatagtta tacctatcat aatcggagga ttcggaaatt gactaatccc tttaatacta 180 ggggcgccag atatagcctt tccccgacta aataatataa gattttgact actgcccccc 240 tcattaactt tacttttaat aggaagaatt gttggtaagg gggccggaac aggttgaaca 300 gtctatcctc cattagcctc tagaactgcc catgaaggag cctcagtaga tttagccatt 360 tttagtcttc acatagcagg tatctcctca attctaggag ctatcaattt catctcaaca 420 gtagccaata tacgccctac tggtataaac ctagagcaaa tacccctatt cagttgagct 480 gtaaagatta cagctatcct tctacttcta tcactacctg ttctcgcagg ggcaatcact 540 atactactaa cagatcgaaa tattaatact tcattct 577 // ID LN889390; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889390; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mechistocerus violatus mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC0908 XX KW . XX OS Mechistocerus violatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Mechistocerus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; defa6e064cb52716c6cc872de1d46cd8. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Mechistocerus violatus" FT /organelle="mitochondrion" FT /isolate="ARC0908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742697" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1R2" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1R2" FT /protein_id="CUR50221.1" FT /translation="MVGTSLSVLIXTELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPXMLGAPDMAFPRLNXMSFWLLPPSLTFLLMSSIVDKGXGTGWTVYPP FT XSTNISHEGASVDLAIFSLHMAGVSSILGAINFISTVFNMHPKGMNPDRLSLFVWAVKI FT TAILLLLSXPVLAGAITMLLTDRNVNTSF" XX SQ Sequence 577 BP; 169 A; 111 C; 86 G; 198 T; 13 other; atagtgggca catccttaag tgtyttaatt yggacagaat tgggtacccc aggaagatta 60 attggagatg atcaaatcta taatactatt gtcactgctc atgcctttat tataattttt 120 tttatagtta tacctattat aattggagga tttggaaact gacttgttcc tyttatatta 180 ggagcccctg atatagcttt ccctcgacta aataawataa gattytgact acttccccch 240 tctctaacct tyttattaat aagaagcatt gttgacaaag gatytggaac tggatgaacm 300 gtataccccc cccyatctac taatatytcc catgaaggag cctcggtaga tctcgctatt 360 tttagacttc atatagccgg agtttcatct attcttggag ctattaactt tatttccaca 420 gtttttaata tacacccaaa aggaataaat ccagaccgac tatctttatt tgtytgagca 480 gtaaaaatta cagccatcct attattgtta tctytcccag ttctagcagg agctattaca 540 atacttttaa cagaccgaaa cgttaatact tcttttt 577 // ID LN889391; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889391; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC0909 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC0909 XX KW . XX OS Cryptorhynchini gen. sp. ARC0909 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 28f59fc2e198897432881366e7cdbdd1. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchini gen. sp. ARC0909" FT /organelle="mitochondrion" FT /isolate="ARC0909" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742676" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1W6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1W6" FT /protein_id="CUR50222.1" FT /translation="MVGTSMSVLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTXXXSSSILDKGAGTGWTVYPP FT LSANIAHEGASIDLAIFSLHMAGMXSILGAMNFIXTITNMRPKGMKLEQMPLFVWAVKX FT TAIXLXLSLPVLAGAITMLLTDRNINTXF" XX SQ Sequence 577 BP; 180 A; 99 C; 79 G; 209 T; 10 other; atagtaggca cttcaataag tgtcctaatt cgaactgaat taggaaatcc aggaacttta 60 attggtaatg atcaaattta caactctatt gttacagccc atgcctttat tataattttt 120 tttatagtta tacctattat aattggggga tttggaaatt gattagttcc tttaatactt 180 ggagctcctg atatagcttt tccacgactc aacaatataa gattctgact acttccgcct 240 tcmttaacty ttyttytttc aagaagaatt cttgacaaag gagccggaac aggttgaact 300 gtataccctc ctttatcagc aaatattgcc catgaaggag cttcaattga tttagcaatt 360 tttagactcc atatagcagg tatatyttca attttaggag caataaattt tatttytaca 420 attaccaata tacgccctaa aggaataaaa ttagaacaaa tacctttatt tgtctgagct 480 gtaaaaawta cagctattyt tcttyttctt tctttacctg ttctagctgg agctatcacc 540 atattattaa cagatcgtaa tatcaataca tyttttt 577 // ID LN889392; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889392; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tyrtaeosus coelosternoides mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC0912 XX KW . XX OS Tyrtaeosus coelosternoides OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tyrtaeosus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; dbd74d3f92ae696d00aa5233352577ca. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Tyrtaeosus coelosternoides" FT /organelle="mitochondrion" FT /isolate="ARC0912" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738215" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0B3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0B3" FT /protein_id="CUR50223.1" FT /translation="MLGTSLSMLIXTELGNPGTLIGNDQIYNSIVTAXAFJMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLXPPSLTLLLMSSITDKGAGTGWTVYPP FT LXANIAHEGASVDLAIFSLHMAGIXXILGAINFISTIMNMRPKGMSSDRMTLFSWAVKX FT TAIXLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 176 A; 98 C; 77 G; 214 T; 12 other; atattaggaa cctctttaag aatattaatt ygtacagaat taggaaatcc aggaacttta 60 attggaaatg atcaaattta taattctatt gttacagccc mtgctttcmt tataattttt 120 tttatagtaa taccaattat aattggggga ttcggaaatt gattaattcc tttaatacta 180 ggagcaccag atatagcttt cccacgacta aataatataa gattttgact tytcccaccc 240 tcmttaactc ttttattaat aagaagaatt actgacaaag gtgcaggtac aggatgaaca 300 gtttaccccc cmttatytgc taatatcgct catgaaggtg catctgttga tttagctatt 360 tttagtcttc atatagcagg aatttyttyt attctaggag ctattaactt tatttctaca 420 attataaata tacgtcctaa aggtataagc tctgatcgaa taactctctt ttcttgagca 480 gtaaaaawta ctgccattyt tytacttctt tcacttcctg tccttgcagg agcaatcact 540 atacttctta ctgatcgtaa tattaatact tcttttt 577 // ID LN889393; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889393; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Deretiosus aridus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0917 XX KW . XX OS Deretiosus aridus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Deretiosus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2918b9d46da2107adcf3ad2d285b6344. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Deretiosus aridus" FT /organelle="mitochondrion" FT /isolate="ARC0917" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738243" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1R3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1R3" FT /protein_id="CUR50224.1" FT /translation="MVGTSLSMMIRTELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSANIAHEGASVDLAIFSLHLAGISSIXGAINFISTIMNMHPAGMKLDQLTLFSWAVKI FT TAILLLLSLPVLAGAITMLXTDRNINTSF" XX SQ Sequence 577 BP; 191 A; 86 C; 81 G; 217 T; 2 other; atggttggaa cttcattaag aataataatt cgaacagaat taggaaatcc aggaagatta 60 attggaaatg atcaaattta taatactatt gtaactgctc atgcttttat tataattttt 120 tttatagtaa taccaattat aattggagga tttggtaact gacttgtccc tttaatatta 180 ggggctcctg atatagcatt tcctcgatta aataatataa gattttgatt attaccccct 240 tctttaactt tattattaat aagaagaatt attgataaag gagcaggaac tggatgaact 300 gtttatcctc ctttatcagc taatattgca catgaaggag cctcagtaga tttggctatt 360 tttagcttac atttagcagg aatttcatct attyttggag ctattaattt tatttcaact 420 attataaata tacaccctgc aggaataaaa ttagaccaat taaccttatt ttcttgagca 480 gttaaaatca cagctatttt acttttatta tcattgccag ttctagcagg agctattacc 540 atacttytta cagaccgaaa tattaatacc tcatttt 577 // ID LN889394; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889394; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Talanthia sp. ARC0921 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC0921 XX KW . XX OS Talanthia sp. ARC0921 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Talanthia; unclassified Talanthia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a28ad7b8ad97e3efaff09c3459d7303a. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Talanthia sp. ARC0921" FT /organelle="mitochondrion" FT /isolate="ARC0921" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737018" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KYT9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYT9" FT /protein_id="CUR50225.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLLSSAVDKGAGTGWTVYPP FT LSSNIGHEGTSVDLAIFSLHMAGVXSILGAINFIXTIINMRSKGMKPEQMSLFIWAVQI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 178 A; 112 C; 86 G; 194 T; 7 other; atagtaggaa cctctttaag tatactaatt cgaactgaat taggaaaccc ggggagatta 60 atyggaaatg atcaaattta caatactatt gttacagccc atgcttttat tataattttc 120 tttatagtta tacctattat aatcggagga ttcggaaact gactagtccc tttaatacta 180 ggggccccag acatagcttt ccctcgatta aataatataa gtttytgatt attaccccca 240 tccctaacct tacttctatt aagaagagcc gttgataaag gagcaggaac cggatgaaca 300 gtttatccac ctttatcctc aaatatcggc catgaaggaa cctctgttga tctagcaatt 360 tttagacttc atatagctgg ggtttyttct atyttagggg caatcaattt tatttytact 420 atcattaata tgcgctcaaa aggaataaag ccagaacaaa tatccctttt tatytgagca 480 gtacaaatta cagccatcct tttactttta tctytaccag ttcttgccgg agctatcacc 540 atactattaa ctgatcgtaa tattaatact tctttct 577 // ID LN889395; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889395; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropteropsis cf. biconifer MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC0924 XX KW . XX OS Poropteropsis cf. biconifer MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropteropsis. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 85186efb887f5b29d2f0a6133dc94c4a. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Poropteropsis cf. biconifer MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC0924" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738363" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L670" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L670" FT /protein_id="CUR50226.1" FT /translation="MVGTSLSVLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLTSSIFDNGAGTGWTVYPP FT LSSNIAHEGASIDLAIFSLHMAGIXSILGAMNFISTIANMRPKGMKLERMPLFVWAVKI FT TAILLLLXXPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 176 A; 97 C; 82 G; 218 T; 4 other; atagttggaa catcacttag agttttaatc cgaactgaac ttggaaaccc tggaacttta 60 attggaaacg atcaaatcta taattctatt gttacagctc atgcttttat tataattttt 120 tttatagtta taccaattat aattggggga tttggtaatt gattagttcc tttgatactt 180 ggagctcctg atatggcttt cccacgtctt aataatataa gattttgact tttaccccca 240 tctttaaccc ttctattaac aagaagaatt tttgataacg gggcaggaac aggatgaaca 300 gtttatcctc ctttatcatc taatattgct catgaaggag cttcaattga tttagcaatt 360 tttagattac atatagcagg tatttyttcc atyttaggag caataaattt tatttcaact 420 attgctaata tacgtcccaa aggaataaaa cttgaacgta taccactttt tgtttgagca 480 gtcaaaatta ctgcaatttt acttttactt tytyttccag ttcttgctgg agcaatcaca 540 atacttttaa cagatcgaaa tattaatacc tctttct 577 // ID LN889396; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889396; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sternochetus mangiferae mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC0929 XX KW . XX OS Sternochetus mangiferae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Sternochetus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b5ea0cf90cfd9f112dcefcb47d888aba. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Sternochetus mangiferae" FT /organelle="mitochondrion" FT /isolate="ARC0929" FT /mol_type="genomic DNA" FT /db_xref="taxon:925794" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ43" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ43" FT /protein_id="CUR50227.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRXNNMSFWLXPPSLTLLLMSSIIDKGAGTGWTVYPP FT LXANIAHEGAAIDLAIFSLHLAGIXXILGAMNFIXTIINMHPTGMKLDQFPLFVWAVKI FT TAILLXLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 96 C; 79 G; 212 T; 8 other; atagtaggaa cttccttaag aatacttatt cgaacagaat taggaaatcc tggaagtctc 60 attggaaatg atcaaattta taattccatc gtcacagcac atgcttttat tataattttt 120 ttcatagtta tacctattat aattggagga tttggtaact gattagttcc tttaatatta 180 ggggctcctg atatagcatt cccacgtytt aacaatataa gattttgact tyttcctcca 240 tcattaacct tacttttaat aagaagaatt attgataaag gggccggtac tggatgaact 300 gtatacccac ctttatytgc caacattgct catgaaggag ctgccattga cttagctatt 360 tttagacttc acttagccgg aatttyttyt attttaggag caataaattt catttytaca 420 attattaaca tacatcctac aggaataaaa ctagatcaat ttccactatt tgtatgagca 480 gttaaaatta cagctatytt acttyttctt tctttaccag tactagcagg agctattact 540 atattattaa ctgatcgaaa tattaataca tcttttt 577 // ID LN889397; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889397; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Xychusa sp. ARC1334 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1334 XX KW . XX OS Xychusa sp. ARC1334 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Xychusa; unclassified Xychusa. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9c57cb49318562c6650cf7e36e90b8b3. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Xychusa sp. ARC1334" FT /organelle="mitochondrion" FT /isolate="ARC1334" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737028" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4F6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4F6" FT /protein_id="CUR50228.1" FT /translation="MLGTSLSMIIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMSSILDKGVGTGWTVYPP FT LSSNIAHEGTSVDLAIFSLHMAGISSILGAMNFISTVINMRPKGMNSDRMPLFIWAVKI FT TAILLILSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 189 A; 85 C; 74 G; 229 T; 0 other; atattaggaa cttccttaag aataattatt cgtactgaat taggtacccc tggaacatta 60 attggtaatg atcaaattta taattcaatt gtaactgctc atgcatttat tataattttt 120 tttatagtaa taccaattat aattggagga tttggaaatt gattaattcc tcttatatta 180 ggagctcctg atatagcttt tcctcgactt aataatataa gattttgact tctcccccct 240 tctttaactt tattaattat aagtagaatt ttagataaag gagtaggtac tggatgaaca 300 gtttatcctc cactatcttc aaatattgct catgaaggaa cttcagttga tttagcaatt 360 tttagattac atatagctgg aatttcatct attttaggag ctataaactt tatttctacc 420 gtaattaata tacgtcctaa aggaataaat tcagatcgaa tacctttatt tatttgagca 480 gtaaaaatta ctgcaattct tcttattctt tcattacctg ttttagcagg agcaattact 540 atattattaa cagatcgtaa tattaataca tcatttt 577 // ID LN889398; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889398; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas patronoides mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1337 XX KW . XX OS Arachnobas patronoides OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 124c6142f309595f5c71b5c43a346d79. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Arachnobas patronoides" FT /organelle="mitochondrion" FT /isolate="ARC1337" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738223" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZP0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZP0" FT /protein_id="CUR50229.1" FT /translation="MLGTSLSMLIRTELGNPGMLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLVMSSIVNSGAGTGWTVYPP FT LSSNTAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPKGMNPDRTPLFVWAVNI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 177 A; 121 C; 85 G; 194 T; 0 other; atactaggaa cttcactaag aatactaatc cgtacagaac tgggtaaccc aggtatatta 60 attggcaatg atcaaatcta taactcaatt gtaacagctc atgcatttat tataattttc 120 tttatagtta tacctattat aattggggga ttcggaaatt gactggttcc attaatatta 180 ggagcccctg atatagcatt cccacgatta aacaatataa gattttgact tttaccccct 240 tccttaacac ttttagtcat aagaagaatc gtaaatagag gggcagggac aggatgaacc 300 gtctaccccc ctctctcatc caacacagcc catgaaggtg cttctgtaga tttagctatt 360 tttagactcc atatagccgg aatctcttca attcttggag caataaattt tatttccact 420 gtaattaata tacgccccaa aggtataaat cctgaccgta cacctttatt tgtttgagcc 480 gtaaatatta cagctatcct tcttttactt tctttaccag ttctagcagg agctattact 540 atacttttga cagatcgaaa cattaatact tcctttt 577 // ID LN889399; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889399; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe sp. ARC1338 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1338 XX KW . XX OS Semiathe sp. ARC1338 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe; unclassified Semiathe. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 21c8b9b6b95923dda9963d74161af2f1. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Semiathe sp. ARC1338" FT /organelle="mitochondrion" FT /isolate="ARC1338" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736949" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L3X8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3X8" FT /protein_id="CUR50230.1" FT /translation="MVGTSLSVLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSFIDKGAGTGWTVYPP FT LSSNLAHEGISVDLAIFSLHMAGISSILGAINFISTTINMRPLGMMMDRLPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 180 A; 108 C; 84 G; 205 T; 0 other; atagtcggaa cttcattaag agtcctaatt cgaacagaac taggaactcc tggaacttta 60 attggtaatg accaaatcta taactctatt gtcacagcac atgcttttat tataattttt 120 tttatagtaa taccaattat aatcggagga ttcggaaatt gactagtgcc tttaatactc 180 ggagctcctg atatagcctt cccacgatta aataatataa gattttggct actaccccct 240 tcactttctt tattattgat aagaagattt attgacaaag gagccggaac aggttgaaca 300 gtctaccccc ctttatcatc aaatctagct catgaaggaa tttcagttga tctagcaatt 360 tttagcctcc atatagcagg aatttcttca attttagggg ctattaattt tatttctact 420 actattaata tacgaccttt ggggataata atagatcgtt tacctttatt tatttgagca 480 gtaaagatta ctgctatttt actattacta tctttaccgg ttttagcagg agcaatcact 540 atacttttaa cagaccgaaa tatcaacacc tcatttt 577 // ID LN889400; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889400; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas tricolor mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1339 XX KW . XX OS Arachnobas tricolor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e149483e3f83df1e40c0fb593c935e98. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Arachnobas tricolor" FT /organelle="mitochondrion" FT /isolate="ARC1339" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738226" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZB7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZB7" FT /protein_id="CUR50231.1" FT /translation="MLGTSLSMLIRTELGSPGMLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLVMSSIVNSGAGTGWTVYPP FT LSSNTAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPKGMNPDRTPLFVWAVNI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 163 A; 134 C; 90 G; 189 T; 1 other; atactgggaa cttctctcag aatattaatc cgcacagaac taggcagccc aggtatatta 60 atcggtaacg atcaaatcta caactcaatc gtcacagctc atgcgtttat tatgattttt 120 tttatagtta tacccattat aattggggga tttggaaatt gattagtccc cctaatacta 180 ggagcycctg atatagcgtt cccccgatta aataatataa gattttggct tctcccccct 240 tccttaacac ttttagttat aagaagaatt gtaaatagag gggcaggaac tggatgaaca 300 gtgtatcccc ccctttcttc caacacagcc catgaaggtg cttccgtaga cctagctatt 360 ttcagcctcc acatagccgg tatctcttca attcttggag caataaactt tatttctaca 420 gtaattaata tacgccccaa aggtatgaat cctgaccgta cccctttatt tgtttgagct 480 gttaatatta cagctatcct ccttttactt tctttaccag tcctagcagg ggctatcact 540 atacttttaa cagatcgaaa tatcaacact tcttttt 577 // ID LN889401; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889401; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe cf. puncticollis MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1340 XX KW . XX OS Semiathe cf. puncticollis MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2094d883cd16f6b0c075f19592c7654b. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Semiathe cf. puncticollis MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1340" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738368" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L255" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L255" FT /protein_id="CUR50232.1" FT /translation="MIGTSLSVLIRTELGNPGPFIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSILGAINFISTITNMRPEGQTFDRLPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 171 A; 113 C; 86 G; 207 T; 0 other; ataatcggaa cctctttgag agttttaatt cgtacagaat taggtaaccc cggacctttt 60 attggaaacg accaaattta taattctatt gttacagcac atgcatttat tataattttt 120 tttatagtaa taccaattat aatcggggga ttcggaaatt gattagttcc ccttatacta 180 ggagctccag acatagcctt cccacgatta aataatataa gattttgact tttaccccct 240 tctttaactt tattactaat aagaagtatt attgataaag gggccggaac tgggtgaact 300 gtttaccccc cactatcttc taatattgcc cacgaagggg cttctgtaga tttagcaatt 360 tttagcctcc acatagccgg aatctcctct attttaggag ctattaattt tatttcaaca 420 attactaata tacgtccaga aggccaaact tttgatcgtt tacctctatt tgtctgggcc 480 gtaaaaatta ctgcaattct attactttta tctttaccag ttttagccgg ggccatcaca 540 atattattga cagatcgaaa tattaatact tcatttt 577 // ID LN889402; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889402; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas pauxillus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1343 XX KW . XX OS Arachnobas pauxillus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 07bd80d30c0776d474723186fcb7e62f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Arachnobas pauxillus" FT /organelle="mitochondrion" FT /isolate="ARC1343" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738224" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1N7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1N7" FT /protein_id="CUR50233.1" FT /translation="MVGTSLSMLIRTELGNPGMLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMSSIVDNGAGTGWTVYPP FT LSSNLAHEGTSVDLAIFSLHMAGISSILGAMNFISTVINMRPKGMDPDRTPLFVWAVEI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 163 A; 122 C; 91 G; 201 T; 0 other; atagtgggca cctcccttag catattaatt cgcactgaac ttggaaaccc tggcatacta 60 attggaaatg atcaaattta taactctatt gttacagccc atgcttttat tataattttt 120 tttatagtaa tacctatcat aattggaggt tttggtaatt gattagtccc tttaatactc 180 ggggcccctg atatagcatt ccctcgatta aataatataa gattttggct actcccccca 240 tcactaactc ttttaattat aagaagaatt gtagacaatg gggctgggac agggtgaact 300 gtttaccccc ctctctcttc aaatctagcc catgaaggaa cttcagttga tttagctatt 360 tttaggttac atatagcagg aatctcatct attctagggg caataaattt catttctaca 420 gtaattaata tacgccccaa aggaatagac ccagatcgca cacccttatt tgtatgggcc 480 gttgaaatta ctgctattct tctccttctc tcccttcctg tcttagctgg ggctattact 540 atacttttga cagatcgaaa tattaataca tcatttt 577 // ID LN889403; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889403; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Idopelma unicolor mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1346 XX KW . XX OS Idopelma unicolor OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Idopelma. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ecff33261886a1079d776dd9c78a7058. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Idopelma unicolor" FT /organelle="mitochondrion" FT /isolate="ARC1346" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738204" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1S7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1S7" FT /protein_id="CUR50234.1" FT /translation="MVGTSLSMIIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSIILLLSSNILDNGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGISSILGAMNFISTVANMRPKGVNPERMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 93 C; 79 G; 223 T; 0 other; atagttggaa cttctttaag aataattatt cgaactgaat taggaactcc tggaacatta 60 attggtaatg atcaaattta taattcaatt gttacagcac atgcatttat tataattttt 120 tttatagtta taccaattat aattgggggc ttcggaaatt gattaattcc tcttatatta 180 ggggctcctg atatagcttt tccccgtctc aataatataa gattttgact tttaccacca 240 tcaattattc ttttattatc aagtaatatt ttagataatg gagccggaac aggttgaaca 300 gtttatcccc ctttatcctc aaatgtagct catgaaggaa tttcagtaga tctagctatt 360 tttagtcttc atatagcagg aatttcctct attcttggag caataaattt tatttctaca 420 gttgctaata tacgacctaa aggagtaaat cctgaacgaa tacctctctt tatttgagct 480 gtaaaaatta cagcaattct tttattatta tctttacctg ttttagccgg agcaattaca 540 atattattaa ctgatcgtaa tattaacaca tcatttt 577 // ID LN889404; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889404; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas sectator mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1347 XX KW . XX OS Arachnobas sectator OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fbfa4f2a9fd86ae7e73b7461a8e6a078. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Arachnobas sectator" FT /organelle="mitochondrion" FT /isolate="ARC1347" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738225" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L471" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L471" FT /protein_id="CUR50235.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIVDKGAGTGWTVYPP FT LSSNIAHGGASVDLAIFSLHMAGISSILGAMNFISTVANMRPKGMNPDRMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 106 C; 89 G; 200 T; 0 other; atagtgggaa cttcattaag tatactaatt cgaacagaac ttgggaatcc tggtacttta 60 attgggaatg atcaaatcta taattctatt gttacagccc atgcttttat tataattttt 120 tttatggtaa taccaattat aattggggga tttgggaact ggttagtccc cctaatacta 180 ggagcccccg atatagcttt cccacgatta aataatataa gattttgact tcttcccccg 240 tctttatctt tattacttat aagaagaatt gtagataaag gagcaggaac tggatgaaca 300 gtttatcctc ctctttcctc aaatattgca catggaggag cttctgtaga tttagcaatt 360 ttcagattac atatagcagg aatttcttca attctaggag caataaactt tatctccaca 420 gtagcaaata tacgacctaa aggaataaac cctgatcgaa tacctctttt tgtatgagct 480 gtaaaaatta ctgccatttt actattactt tctttaccag ttttagcagg agcaattacc 540 atacttttaa cagatcgaaa catcaataca tcctttt 577 // ID LN889405; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889405; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Mormosintes cf. nodosus MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1362 XX KW . XX OS Mormosintes cf. nodosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Mormosintes. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e2ac5ea08ca65098ed100455caa93324. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Mormosintes cf. nodosus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1362" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738356" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ38" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ38" FT /protein_id="CUR50236.1" FT /translation="MIGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIINKGAGTGWTVYPP FT LSSYSAHEGASVDLAIFSLHMAGISSILGAMNFISTLMNMRPTGMTPDRMPLFIWAVKI FT TAILLLLSLPVLASAITMLLTDRNMNTSF" XX SQ Sequence 577 BP; 181 A; 118 C; 79 G; 199 T; 0 other; ataatcggca cttccctaag aatacttatt cgaactgaac taggaacgcc aggtacttta 60 atcggaaatg atcaaatcta taactcaatt gtaacagctc atgcttttat tataattttt 120 tttatagtaa tacctattat aattggagga tttggaaact ggcttattcc tttaatatta 180 ggagcccctg atatggcctt cccacgactt aataatataa gattttgatt attacctcct 240 tctctaactc tccttttaat aagtagaatt attaataaag gggctggaac aggctgaaca 300 gtataccccc cactatcttc ttattcagcc catgaaggag cctcagtaga tttggctatt 360 tttagtctcc atatagcagg gatctcctca atcttagggg caataaattt catctcaact 420 ctaataaata tacgaccaac tggaataacc cccgatcgta tacctttatt tatttgagct 480 gtaaaaatta ctgcaatttt attactccta tcactcccag tcttagctag agctattact 540 atacttttaa cagatcgaaa tataaatact tcatttt 577 // ID LN889406; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889406; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lophocheirus cf. maior MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1364 XX KW . XX OS Lophocheirus cf. maior MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Lophocheirus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 420794e734697e2d9f72369732e17c09. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Lophocheirus cf. maior MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1364" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738350" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1S9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1S9" FT /protein_id="CUR50237.1" FT /translation="MIGTSLSVLIRTELSNSGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGVGTGWTVYPP FT LSSNMAHEGISVDLGIFSLHMAGISSILGAINFISTIINMRPEGMTLDRLPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 115 C; 87 G; 196 T; 0 other; ataatcggaa catccctaag agtcttaatc cgtacagaac tcagaaactc gggtacctta 60 atcggaaatg accaaattta taactctatc gtaacagccc acgctttcat tataattttc 120 ttcatagtta tacctattat aattggggga ttcggtaatt gattagtgcc tttaatatta 180 ggagcccctg atatggcctt ccctcgacta aataatataa gattttgact tcttccccct 240 tccctaactc ttctcttaat aagaagaatt attgataaag gagtgggaac aggatgaaca 300 gtatatccac cattatcaag aaatatagct catgaaggaa tctctgtaga tttaggtatt 360 tttaggctcc atatagcagg aatctcatca attttagggg ctattaactt tatttcaacc 420 attattaata tacggccgga aggaataacc cttgaccgcc tacctctatt tgtttgagca 480 gtaaaaatta cagctattct tttattatta tctctcccag ttttagccgg cgcaattact 540 atattattaa ctgaccgaaa tattaatact tcttttt 577 // ID LN889407; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889407; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Salcus granulatus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1365 XX KW . XX OS Salcus granulatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Salcus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d47cbd8528bf1b21618da251f479db9f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Salcus granulatus" FT /organelle="mitochondrion" FT /isolate="ARC1365" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738283" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Y0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Y0" FT /protein_id="CUR50238.1" FT /translation="MAGTSLSMLIRAELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT VMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LASNVTHEGASVDLAIFSLHMAGISSILGAMNFISTIINMRPMGMNHDRMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 110 C; 84 G; 201 T; 0 other; atggcaggta catctttaag aatattaatt cgagcagaat taggaaatcc aggaacattg 60 attggtaatg atcaaatcta taactcaatt gtaactgcac atgcctttat tataatcttt 120 tttatagtaa taccagttat aattggagga tttggaaatt gattaattcc tttaatatta 180 ggtgcccctg atatagcctt ccctcgactt aacaatataa gattttgact actaccaccc 240 tcacttaccc ttcttcttat aaggagaatt attgataaag gagccggaac agggtgaaca 300 gtctatcccc ccttagcctc aaatgtaacc catgaaggag cttctgttga cttagccatt 360 tttagacttc atatagcagg tatttcttct attttagggg caataaattt tatttctaca 420 atcattaata tacgaccaat aggaataaac cacgatcgaa tacctctttt tgtctgagca 480 gtaaaaatta cagctattct actacttctt tccttacctg tattagctgg tgctattact 540 atattactaa cagatcgaaa tattaatact tcctttt 577 // ID LN889408; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889408; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Autillia horridipes mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1366 XX KW . XX OS Autillia horridipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Autillia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 564ebb6229f057a688f8d26c3938f9f5. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Autillia horridipes" FT /organelle="mitochondrion" FT /isolate="ARC1366" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738230" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0D5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0D5" FT /protein_id="CUR50239.1" FT /translation="MIGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIINNGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGISSILGAMNFISTIINMRPMGMKFDRIPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 184 A; 103 C; 78 G; 212 T; 0 other; ataattggaa catctttaag aatattaatc cgcactgagt taggaaaccc aggaacatta 60 attggaaatg accaaattta taactctatt gtcactgccc acgcatttat tataatcttc 120 tttatagtta tgccaattat aattggaggt ttcggaaatt gattagttcc tttaatatta 180 ggggccccag atatagcatt tcctcgtctt aacaatataa gattttgact tttaccacct 240 tctttaactt tactacttat aagaagaatc attaataatg gagcaggaac aggatgaact 300 gtttacccac cattatcttc taatgtagct catgaaggaa tttccgtaga cttagctatt 360 tttagccttc atatagctgg tatctcctca atcttaggag caataaattt tatttcaaca 420 attatcaata tacgccctat aggaataaaa tttgatcgaa ttccattatt tgtttgagct 480 gttaaaatta cagcaattct tcttctttta tctcttccag ttttagcagg agcaattact 540 atacttctaa ctgatcgtaa tattaataca tcatttt 577 // ID LN889409; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889409; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Telaugia subtilis mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1371 XX KW . XX OS Telaugia subtilis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Telaugia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9cd4af570e7c1eb5c1b26b2ed2998dba. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Telaugia subtilis" FT /organelle="mitochondrion" FT /isolate="ARC1371" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738210" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1S8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1S8" FT /protein_id="CUR50240.1" FT /translation="MLGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGVGTGWTVYPP FT LSSNVAHEGTSVDLAIFSLHMAGISSILGAMNFISTVINMRPKGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 116 C; 76 G; 200 T; 3 other; atactaggta cttccttaag aatattaatc cgcactgaat taggaaaccc cggaacttta 60 atcggaaatg atcaaattta taactcaatt gtcacagctc acgcctttat cataattttt 120 tttatagtta taccaatcat aattggaggr tttggaaact gattaattcc tttaatatta 180 ggagccccag atatagcttt tccccgtctt aacaatataa gattttgact attaccaccc 240 tctttaacac ttcttcttat aagaagaatt atcgacaaag gggtcggcac tggatgaaca 300 gtttatccyc ccytatcttc aaacgtagcc catgaaggaa cttcagttga tttagcaatt 360 tttagtctcc atatagccgg aatctcttca attttaggtg ctataaattt tatttcaaca 420 gtaattaata tacgacctaa aggaataaac ccagatcgca tacccttatt tatttgagct 480 gtaaaaatta ccgctatttt attacttctt tctcttcctg tattagccgg agcaattacc 540 atattattaa cagaccgaaa tattaacact tcttttt 577 // ID LN889410; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889410; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tyrtaeosus sp. ARC1380 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1380 XX KW . XX OS Tyrtaeosus sp. ARC1380 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tyrtaeosus; unclassified Tyrtaeosus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6e0f0b096655c7c63f27581d53ce6b2f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Tyrtaeosus sp. ARC1380" FT /organelle="mitochondrion" FT /isolate="ARC1380" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737026" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KYX3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYX3" FT /protein_id="CUR50241.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIIDKGAGTGWTVYPP FT LSNNIAHEGASVDLAIFSLHMAGISSILGAMNFISTIMNMRPMGMNPDRMPLFIWSVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 183 A; 100 C; 76 G; 218 T; 0 other; atggtcggaa cttccttaag aatactaatt cgtactgaat taggaaatcc aggaacttta 60 attggaaatg accaaattta taattctatt gttacagctc atgcttttat tataattttt 120 tttatagtta tacctattat aattggagga ttcggaaatt gattaattcc tctaatatta 180 ggagcccccg atatagcttt cccacgttta aataatataa gattttgact tttacccccc 240 tccctatctc ttcttttaat aagaagaatt attgacaaag gagctggtac tggttgaaca 300 gtctatcccc ctttatcaaa caatattgca catgagggag catcagtaga tttagctatc 360 tttagacttc atatagcagg aatttcatct attcttggtg ctataaattt tatttctaca 420 attataaata tacgacctat aggtataaat ccagatcgta tacctttatt tatttgatca 480 gtaaaaatta ctgcaatttt attacttcta tctttaccag ttttagccgg agctattact 540 atacttttaa ctgatcgaaa cattaataca tcattct 577 // ID LN889411; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889411; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Meroleptus sp. ARC1383 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1383 XX KW . XX OS Meroleptus sp. ARC1383 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Meroleptus; unclassified Meroleptus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8963c1282a32206c75205a36f8f22de3. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Meroleptus sp. ARC1383" FT /organelle="mitochondrion" FT /isolate="ARC1383" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736982" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L688" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L688" FT /protein_id="CUR50242.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPAGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 183 A; 99 C; 84 G; 211 T; 0 other; atagtaggaa cttctctaag aatattaatt cgtactgaac taggtaatcc tggaaccttg 60 attggaaacg atcaaattta taattcaatt gttactgctc atgcttttat tataattttt 120 tttatagtta tacctatcat aattggggga tttggaaatt gattaattcc attaatatta 180 ggagccccag atatagcttt tcctcgtctt aataatataa gattttggct actacccccc 240 tctctaactc ttcttttaat aagaagtatt attgataaag gagcaggtac aggttgaaca 300 gtatatccac ctctctcatc aaatgtggcc catgagggag cctcagtaga tttagcaatt 360 tttagattac atatagcagg aatttcatca attttagggg caataaattt tatttctaca 420 gtaatcaata tacgaccagc aggtataaat cctgatcgaa tacctctttt tatttgagca 480 gtaaaaatta ctgctatttt acttctttta tctcttccag tattagcagg agcaatcaca 540 atactcttaa ctgatcgaaa tattaatact tcatttt 577 // ID LN889412; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889412; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Microporopterus cf. interruptus MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1384 XX KW . XX OS Microporopterus cf. interruptus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Microporopterus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 338cc3febfca87096c412caaf1103cb3. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Microporopterus cf. interruptus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1384" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738353" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ59" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ59" FT /protein_id="CUR50243.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIMDKGAGTGWTVYPP FT LSSNVAHEGASVDLAIFSLHMAGVSSILGAMNFISTVINMHPMGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 187 A; 101 C; 79 G; 208 T; 2 other; atagttggaa cttcactaag tatactaatt cgtacagaat taggaaaccc aggaacatta 60 atcggaaatg atcaaattta taattcaatt gttacagctc atgctttcat cataattttt 120 tttatagtta taccaatcat aattggaggg ttcggaaatt gattaatccc attaatatta 180 ggagcmccag atatagcatt tcctcgatta aataatataa gattttgact tttaccccct 240 tctttaaccc ttcttttaat aagaagaatt atagataaag gagccggaac tggatgaact 300 gtctaccccc ctttatcatc taatgtggcc catgaaggtg cttctgttga tttagctatt 360 tttagattac atatagcagg agtttcttca attttaggag caataaattt tatttcaaca 420 gtaattaata tacacccaat aggaataaac ccagaccgaa tacctttatt tatttgagcc 480 gtaaaaatta cagctatytt acttcttctt tctcttcctg ttttagcagg agctattacc 540 atacttttaa ctgatcgaaa tattaatact tcatttt 577 // ID LN889413; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889413; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Microporopterus cf. setosus MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1392 XX KW . XX OS Microporopterus cf. setosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Microporopterus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ddc4ffcb19f97e0ef5fe4c9160618c47. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Microporopterus cf. setosus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1392" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738354" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4H3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4H3" FT /protein_id="CUR50244.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVNKGAGTGWTVYPP FT LSANIAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPMGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 194 A; 105 C; 81 G; 197 T; 0 other; atagtcggaa cttcattaag aatattaatc cgaacagaac taggaaaccc aggaacttta 60 atcggaaacg accaaattta taattctatt gtaacagctc atgcttttat tataattttt 120 tttatagtaa tacctatcat aattggagga ttcggaaatt gattaattcc acttatatta 180 ggggcacctg atatagcatt tccacgactt aacaatataa gattttgact acttccacca 240 tctctaacac ttttacttat aagaagaatt gttaataaag gagctgggac cggttgaaca 300 gtttaccccc ctttatcagc caatatcgct catgagggag cctctgtaga tttagcaatt 360 tttagtcttc atatagcagg aatttcttca attttaggag caataaactt tatttcaaca 420 gtaattaata tacgtccaat aggaataaac ccagaccgca tacctctttt tatttgagca 480 gtaaaaatta cagctatttt attattatta tctcttccag tcttagcagg agccattaca 540 atactattaa cagatcgaaa tattaatact tcgtttt 577 // ID LN889414; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889414; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alatidotasia sp. 1 MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1395 XX KW . XX OS Alatidotasia sp. 1 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Alatidotasia; unclassified Alatidotasia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0a36ed50a4fb6f359c457a175dd3feca. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Alatidotasia sp. 1 MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1395" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742683" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZQ4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZQ4" FT /protein_id="CUR50245.1" FT /translation="MIGTSLSVLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIIDKGAGTGWTVYPP FT LSANLAHEGASVDLAIFSLHMAGISSILGAINFISTIINMRPMGMSMDRLPLFAWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 171 A; 102 C; 84 G; 220 T; 0 other; atgattggaa cctcattaag agttttaatt cgaacagaac ttggaaatcc tggaagatta 60 attggaaatg atcaaattta taattctatt gtaactgctc atgcttttat tataattttt 120 tttatagtta tacctattat aattggaggt tttggaaatt gattagtccc gttaatgctt 180 ggtgctcctg atatagcttt cccccgatta aataatataa gattctggct tctccctcct 240 tccttatccc ttttattaat aagaagtatt attgataaag gagcaggaac aggatgaacc 300 gtttatcctc cattatctgc taatctcgcc cacgaaggag catctgtaga tttagctatt 360 tttagattac atatagcagg aatttcatct attctaggag ccattaattt tatctctaca 420 attattaata tacgtccaat aggtatatca atagatcgcc ttccattatt tgcctgagca 480 gttaaaatca ctgctatttt attactttta tctttaccgg tccttgctgg agccattact 540 atacttttaa cagatcgaaa tattaatact tcattct 577 // ID LN889415; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889415; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alatidotasia sp. 2 MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1401 XX KW . XX OS Alatidotasia sp. 2 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Alatidotasia; unclassified Alatidotasia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7000da7a58632433ba5354562c434105. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Alatidotasia sp. 2 MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1401" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742684" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L3Z4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L3Z4" FT /protein_id="CUR50246.1" FT /translation="MIGTSLSVLIRTELGNPGSLINNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIIDKGAGTGWTVYPP FT LSANLAHEGASVDLAIFSLHMAGISSILGAINFVSTIINMRPFGMKMDRLPLFVWAVKI FT TAILLLLSLPVLASAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 102 C; 81 G; 212 T; 0 other; ataattggaa cctcccttag agtacttatt cgaacagagt taggtaatcc aggaagatta 60 attaataatg atcaaattta taattccatt gtaactgctc atgcctttat cataattttt 120 tttatagtta tacctattat aattggagga tttggaaatt gacttgtacc tttaatatta 180 ggagctccag acatagcttt cccacgactt aataatataa gattctgact tctaccccct 240 tcattatccc ttttattaat aagaagaatt attgataaag gagcaggaac agggtgaact 300 gtttaccccc ctttatcagc taatttagcc catgaaggag cttctgtaga tttagctatt 360 tttagattac atatagcagg aatctcatct attttagggg ccattaattt tgtttccaca 420 attattaata tacgaccttt tggtataaaa atagaccgtt tacctttatt tgtttgagct 480 gttaaaatca cagctatcct tttattatta tcgctaccag ttttagctag agcaatcaca 540 atactattaa cagaccgaaa tattaatacc tctttct 577 // ID LN889416; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889416; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Idopelma sp. ARC1406 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1406 XX KW . XX OS Idopelma sp. ARC1406 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Idopelma; unclassified Idopelma. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 576f37c7837f407073a01e4f4b057d20. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Idopelma sp. ARC1406" FT /organelle="mitochondrion" FT /isolate="ARC1406" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736974" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZD1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZD1" FT /protein_id="CUR50247.1" FT /translation="MVGTSLSMIIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSIILLLSSSILDKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGISSILGAMNFISTMANMYPQGVTPERMTLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 93 C; 76 G; 229 T; 0 other; atagtaggaa cttctttaag tataattatt cgaacagaac taggtacccc tggaacttta 60 attggaaatg accaaattta taattcaatt gttacagctc atgctttcat tataattttt 120 tttatagtta taccaattat aattggggga tttggaaatt gattaattcc cttaatatta 180 ggagcacccg atatagcttt tcctcgtctt aataatataa gattttgatt attaccccca 240 tcaattattc ttttattatc aagtagaatt ttagataaag gagctggaac aggatgaaca 300 gtttatcctc ctttatcctc aaatattgct catgaaggta tttctgtaga tttagctatt 360 tttagtcttc atatagcagg aatttcctct attcttggag caataaattt tatttctaca 420 atagctaata tatatcctca aggtgttacc cctgaacgta taactctttt tatttgagct 480 gtaaaaatta cagcaatttt attactttta tctcttcctg tcctagctgg agctattaca 540 atattactaa ctgatcgtaa tattaatact tcatttt 577 // ID LN889417; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889417; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semiathe cf. linnei MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1407 XX KW . XX OS Semiathe cf. linnei MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semiathe. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9aaa5f6af2b01f4df093677df2e18dd7. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Semiathe cf. linnei MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1407" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738367" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L269" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L269" FT /protein_id="CUR50248.1" FT /translation="MVGTSMSVLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSFIDKGAGTGWTVYPP FT LSSNLAHEGTSVDLAIFSLHMAGISSILGAINFISTTMNMRPSGMNLDQMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 190 A; 106 C; 79 G; 202 T; 0 other; atagtaggaa catcaataag agttttaatc cgtacagaat taggaacccc tggaacatta 60 attggaaatg atcaaattta taactcaatt gtaactgccc acgctttcat tataattttt 120 tttatagtaa taccaattat aattggagga ttcggaaatt gactagttcc cttaatactc 180 ggagcaccag atatggcctt tcctcgacta aataatataa gattctgact cttaccccct 240 tctttatctt tattactaat aagaagattt attgataaag gagctggaac tggatgaaca 300 gtttatcccc ctttatcatc aaatctagcc catgaaggca catcggttga tttagcaatt 360 tttagtttac acatagctgg aatttcttct attttaggag ctattaactt tatctccaca 420 acaataaata tacgaccctc aggaataaac ttagaccaaa tacctttatt tgtttgagca 480 gttaaaatta ctgcaattct attattgtta tctttacctg ttctagccgg tgcaattaca 540 atattattaa cagaccgtaa tattaataca tcatttt 577 // ID LN889418; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889418; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC1553 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1553 XX KW . XX OS Cryptorhynchini gen. sp. ARC1553 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ee30b2251f8dcde828f2f2f80d88be82. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchini gen. sp. ARC1553" FT /organelle="mitochondrion" FT /isolate="ARC1553" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742677" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Q1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Q1" FT /protein_id="CUR50249.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLILLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGISSILGAMNFISTVINMRPMGMSPERMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 187 A; 108 C; 80 G; 202 T; 0 other; atagtaggaa cttctttaag aatactcatt cgaacagaac ttggtaaccc tggaacatta 60 attggaaatg atcaaattta taattcaatc gtaacagctc atgcctttat tataattttc 120 ttcatagtta taccaattat aattggagga tttggaaatt gattaatccc ccttatatta 180 ggagcacctg atatagcctt ccctcgctta aacaatataa gattctgact tttaccgcct 240 tctttaattc tccttttaat aagaagaatt attgataaag gtgcaggaac cggatgaacg 300 gtctatccac cactatcatc aaatgtagct catgaaggaa tttcagttga cttagccatc 360 tttagacttc atatagctgg aatttcatct attttaggag ccataaattt catttcaaca 420 gtaattaata tacgccctat aggaataagc cctgaacgta tacccttatt tatttgagca 480 gtaaaaatta cagctatttt attattacta tctcttcctg tattagccgg agctattact 540 atactactaa cagatcggaa tatcaatact tcttttt 577 // ID LN889419; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889419; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Tychreus sp. ARC1678 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1678 XX KW . XX OS Tychreus sp. ARC1678 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Tychreus; unclassified Tychreus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8e325c39204e9078558e630932f2d167. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Tychreus sp. ARC1678" FT /organelle="mitochondrion" FT /isolate="ARC1678" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737022" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1U2" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1U2" FT /protein_id="CUR50250.1" FT /translation="MVGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMSFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHLAGISSILSAMNFISTIINMRPTEMNLDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 177 A; 112 C; 81 G; 206 T; 1 other; atagtgggaa cctcattaag aatactaatt cgtaccgaat tagggactcc gggaacttta 60 atcggaaatg atcaaattta caattcaatt gttactgccc atgcttttat tataattttc 120 tttatagtca tacccattat aattggrgga ttcggaaact ggctaattcc tctaatatta 180 ggagctcccg atatatcctt ccctcgatta aataatataa ggttctgact tctacccccc 240 tcacttacac tacttttaat aagcagaatt gttgataaag gagctggaac gggttgaaca 300 gtttatcctc ctttatcttc taatattgca catgaaggag catctgtaga tttggctatt 360 tttagattac atttagccgg aatttcctca attttaagag ctataaattt tatttccaca 420 attattaata tacgacccac agaaataaat cttgatcgta tacctctatt tatttgagct 480 gtgaaaatta cagctatcct tctactttta tctctaccag ttctagcagg agcaatcact 540 atacttttaa ctgatcgaaa tatcaatact tcatttt 577 // ID LN889420; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889420; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Nototrigonopterus sp. ARC1679 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1679 XX KW . XX OS Nototrigonopterus sp. ARC1679 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Nototrigonopterus; unclassified Nototrigonopterus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; faa420271d0298b68674e4a55a0f2d0f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Nototrigonopterus sp. ARC1679" FT /organelle="mitochondrion" FT /isolate="ARC1679" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738291" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L487" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L487" FT /protein_id="CUR50251.1" FT /translation="MVGTSLSMIIRTELGTPGSLIGNDQIYNSIVTAHAFIMIFFMVMX FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLLSSIVDKGAGTGWTVYPP FT LSSNIAHQGASVDLAIFSLHLAGISSIXGAMNFISTVLNMRPTGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 163 A; 112 C; 89 G; 211 T; 2 other; atagtgggaa cttctttaag aataattatc cgaaccgaat tagggacccc gggttcttta 60 attggcaatg atcaaattta caactcaatt gtaacagctc atgcattcat cataattttc 120 tttatagtta tacmtatcat aattggtgga tttggtaact gattagttcc cctaatactt 180 ggagctcctg atatagcttt ccctcgacta aataatataa gattttgact tttacctccg 240 tcattaacac ttttattact tagaagaatt gttgataaag gtgccgggac tggctgaaca 300 gtgtatcccc ccctatcatc aaatattgct catcagggag cttctgtgga tttagctatt 360 tttagacttc atttagcagg aatttcctcc attyttgggg ctataaattt tatttcaaca 420 gttcttaata tacgtcccac aggaataaac ccagatcgga tacctctttt tatctgagcc 480 gttaaaatta ccgcaatttt actgcttcta tctttacctg ttttagcggg tgctattact 540 atactattaa cagatcgtaa tattaatact tcatttt 577 // ID LN889421; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889421; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ectatocyba permutata mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1897 XX KW . XX OS Ectatocyba permutata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ectatocyba. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 855fe9c841320804acff6c96e3fa7465. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ectatocyba permutata" FT /organelle="mitochondrion" FT /isolate="ARC1897" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738247" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ56" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ56" FT /protein_id="CUR50252.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPMGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 181 A; 105 C; 82 G; 209 T; 0 other; atagtaggta cttctttaag aatattaatt cgtaccgaat taggaaatcc aggcacatta 60 attggaaatg atcaaattta caactcaatt gtaacagctc atgcctttat tataattttt 120 tttatagtaa taccaattat aatcggagga tttggaaatt gattaattcc attgatattg 180 ggagcaccag atatagcctt tcctcgactt aacaatataa gattttgact gttacctccc 240 tcactctcct tattacttat aagtagaatt attgataaag gagccggaac tggatgaaca 300 gtttatcccc cactatcatc taatgtagcc catgaaggtg cttcagttga tttggccatt 360 tttagtcttc acatagcagg gatttcatca attcttggtg ctataaattt tatttcaaca 420 gtaattaata tacgtccaat aggaataaat ccagatcgca taccactttt tatctgagcc 480 gttaaaatta ccgctatctt attactactt tcattacctg ttttagcagg agctattact 540 atacttctta cagatcgaaa tattaatact tcttttt 577 // ID LN889422; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889422; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sybulus sp. ARC1908 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1908 XX KW . XX OS Sybulus sp. ARC1908 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Sybulus; unclassified Sybulus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 341d9236c138bd0066c29a032c91ff09. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Sybulus sp. ARC1908" FT /organelle="mitochondrion" FT /isolate="ARC1908" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737016" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1U3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1U3" FT /protein_id="CUR50253.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSTNISHEGASVDLAIFSLHLAGISSILGAMNFISTVINMHPTGMNMDQFPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 175 A; 125 C; 79 G; 198 T; 0 other; atagtaggaa cctctctcag aatattaatt cgaactgaac taggaaatcc cggaagatta 60 attggaaacg atcaaatcta taactctatt gttacagccc atgcttttat cataattttc 120 tttatagtta tacctattat aattggggga tttggaaact gactaattcc tctaatactt 180 ggagccccag atatagcttt tcctcgtctt aataatataa gattttgact tcttccacct 240 tccttaactc ttcttttaat aagaagaatt attgataaag gagcaggaac tggctgaaca 300 gtctatcccc ctctctctac caatatctcc catgagggag cttctgttga cctagcaatc 360 ttcagtctcc atctagctgg aatctcctca attttaggag caataaattt tatttctaca 420 gttattaata tacacccaac aggcataaat atagatcaat ttcctctgtt cgtatgagca 480 gtgaaaatta cagctatttt acttctcctt tctctccctg tcctagcagg agcaatcaca 540 atactactaa cagatcgtaa tattaatacc tcttttt 577 // ID LN889423; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889423; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ampagia sp. ARC1917 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1917 XX KW . XX OS Ampagia sp. ARC1917 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ampagia; unclassified Ampagia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2dcee17adf68afe746b5f920828cb1ea. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ampagia sp. ARC1917" FT /organelle="mitochondrion" FT /isolate="ARC1917" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736955" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Z5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Z5" FT /protein_id="CUR50254.1" FT /translation="MVGTSLSMLIRTELSNPGSLIGNDQIYNSIITAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIINKGAGTGWTVYPP FT LSSNIAHQGTSVDLAIFSLHMAGVSSILGAMNFISTVINMHSLGMKLDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 175 A; 113 C; 74 G; 215 T; 0 other; atagtgggaa cctcccttag tatactcatc cgaactgaat taagaaatcc aggaagatta 60 attggaaatg atcaaattta taattccatt atcactgctc atgctttcat tataattttt 120 tttatagtta taccaattat aattggtggg tttggaaact gactaattcc tcttatatta 180 ggtgctcctg atatagcatt cccccgactt aataatataa gattttgact tcttcctcca 240 tctctaaccc ttttattaat aagtagaatt attaataaag gtgccggaac aggctgaact 300 gtttatcccc ctctctcatc caatattgct catcaaggaa cctcagttga tttagcaatt 360 tttagtcttc atatagctgg agtatcctct attctaggag caataaattt tatttccact 420 gtaattaata tacactcttt aggaataaaa cttgatcgaa taccattatt tatttgagcc 480 gtaaaaatca cagcaattct tcttcttctt tccctaccag tacttgctgg tgctattact 540 atacttttaa ctgatcgaaa tattaatacc tcatttt 577 // ID LN889424; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889424; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Miocalles sp. 2 MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1918 XX KW . XX OS Miocalles sp. 2 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Miocalles; unclassified Miocalles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 371d6015002a1dfd7a65c69aa80f0421. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Miocalles sp. 2 MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1918" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738355" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0F0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0F0" FT /protein_id="CUR50255.1" FT /translation="MVGTSLSMLIRTELGTPGMLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSNIIDKGVGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGISSILGAMNFISTVLNMRPMGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTTF" XX SQ Sequence 577 BP; 194 A; 88 C; 77 G; 218 T; 0 other; atagttggaa catcattaag aatattaatt cgaacagaat taggaacccc ggggatatta 60 attggaaatg atcaaattta taattcaatt gtaacagcac atgcatttat tataattttt 120 tttatagtta tacctattat aattggagga tttggtaatt gattaattcc tcttatactt 180 ggtgccccag atatagcttt tcctcgactt aataatataa gattttgatt gttaccacca 240 tctttaacct tacttttaat aagtaatatt attgataaag gagtcggaac tggatgaact 300 gtttatccac ctttatcatc taatattgct catgaaggaa tttctgtaga tttagcaatt 360 tttagacttc atatagcagg aatctcatca attctaggag caataaattt tatttctaca 420 gtattaaata tacgacctat aggaataaat ccagaccgaa tacccctttt tatctgagca 480 gtaaaaatta ctgctatttt attattatta tctttaccag ttttagctgg agctatcaca 540 atattactta ctgatcgaaa tattaatact acattct 577 // ID LN889425; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889425; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lophocheirus sp. large species MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC1925 XX KW . XX OS Lophocheirus sp. large species MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Lophocheirus; unclassified Lophocheirus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2340c8ec25a8a730c20743137d519f76. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Lophocheirus sp. large species MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC1925" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738351" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1U4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1U4" FT /protein_id="CUR50256.1" FT /translation="MVGTSLSVLIRTELSNSGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGVGTGWTVYPP FT LSSNIAHEGISVDLGIFSLHMAGISSILGAINFISTVINMRPKGLTLDRLPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 165 A; 118 C; 96 G; 198 T; 0 other; atagtaggaa cctccttaag agtcctaatt cgcacagaac tcagaaattc gggtactttg 60 atcggaaatg atcaaatcta taactccatt gttacagccc atgcttttat tataattttt 120 tttatagtta tgcctattat aatcggagga ttcggaaatt ggctggtacc cttgatgcta 180 ggggctcccg atatggcctt cccccgacta aataatataa gattttggct tcttccccca 240 tctttaacac ttctattaat aagaagaatt atcgataaag gggttgggac tggttgaaca 300 gtttaccccc cgttatcaag aaatattgct catgaaggca tctcagtaga tttgggaatt 360 ttcagccttc acatagcagg aatttcatca attttagggg ctattaattt tatttcaaca 420 gttattaata tacgccctaa aggattaacc ttagaccgct tacccctatt cgtttgagct 480 gtaaaaatca cagctatcct tttactttta tctttaccgg tccttgcagg cgcaatcact 540 atattattga ctgatcgaaa tattaatact tcctttt 577 // ID LN889426; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889426; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Arachnobas corpulentus mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1930 XX KW . XX OS Arachnobas corpulentus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Arachnobas. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ef679405a7202e5b87f363e494d5f681. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Arachnobas corpulentus" FT /organelle="mitochondrion" FT /isolate="ARC1930" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738222" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KYZ9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KYZ9" FT /protein_id="CUR50257.1" FT /translation="MTGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLILLIMSSITNKGAGTGWTVYPP FT LSANLAHSGTSVDLAIFSLHLAGISSILGAMNFISTVANMHPKGMNLDQMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 183 A; 142 C; 82 G; 170 T; 0 other; ataacgggaa catccctaag tatattaatt cggactgaac taggaaaccc aggaacacta 60 atcggtaatg atcaaatcta taattctatc gttacagccc atgcatttat tataattttt 120 tttatagtaa tacccattat aattggggga tttggaaatt gactaatccc tcttatacta 180 ggagccccag atatagcctt ccctcgatta aacaatataa gattctgact actccccccc 240 tcactaatcc tcctaattat aagaagaatt actaataaag gagccggaac aggatgaacg 300 gtctatcccc cactttctgc aaatttagcc catagaggaa cttctgtaga tttggctatc 360 ttcagcttac acttagctgg aatttcctca atcctggggg caataaattt catttccaca 420 gtagcaaata tacaccccaa aggcataaac ctagaccaga tacccctctt tgtttgagca 480 gtcaaaatta cagccattct tctacttctc tcccttccag tcctagctgg agctattacc 540 atactattaa cagaccgaaa catcaacacc tcatttt 577 // ID LN889427; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889427; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropteropsis sp. ARC1933 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC1933 XX KW . XX OS Poropteropsis sp. ARC1933 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropteropsis; unclassified Poropteropsis. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 51800ef68f5ebc0de459c573f111fbcb. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Poropteropsis sp. ARC1933" FT /organelle="mitochondrion" FT /isolate="ARC1933" FT /mol_type="genomic DNA" FT /db_xref="taxon:1737000" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L6A7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L6A7" FT /protein_id="CUR50258.1" FT /translation="MVGTSLSVLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLSSSIFDSGTGTGWTVYPP FT LSANIAHEGASVDLAIFSLHMAGMSSILGAMNFISTIANMRPKGMELERMPLFVWAVKI FT TTILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 174 A; 102 C; 82 G; 219 T; 0 other; atagttggaa cttcccttag agttttaatt cgaactgaat taggtaatcc aggtacttta 60 attggaaatg atcaaattta taactctatt gttacagccc atgcttttat tataattttt 120 tttatagtta tacctattat aattggagga tttggaaatt gattagtacc acttatatta 180 ggagcccctg atatagcatt tccacgccta aataatataa gattctgact acttccccca 240 tctttaactc ttcttcttag aagaagaatt tttgatagag gaacaggaac aggatgaact 300 gtctacccac ctttatctgc aaatattgct catgagggag cttctgttga tcttgctatt 360 tttagccttc atatagctgg aatatcttca attttaggag caataaattt tatttctaca 420 attgctaata tacgtcctaa aggtatagaa cttgaacgta tacctctttt tgtctgagca 480 gtaaaaatta ctactatttt acttttactt tctctcccag ttctagctgg cgcaattact 540 atacttttaa cagaccgaaa tattaatact tcatttt 577 // ID LN889428; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889428; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Atopomacer podocarpi mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1940 XX KW . XX OS Atopomacer podocarpi OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Nemonychidae; OC Atopomacer. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7a5eb840464d04fbc11aa6cefe980e8f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Atopomacer podocarpi" FT /organelle="mitochondrion" FT /isolate="ARC1940" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738228" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ72" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ72" FT /protein_id="CUR50259.1" FT /translation="MVGTSLSLLIRTELGNPGSLIGDDQIYNVIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLIMSSIVESGAGTGWTVYPP FT LSSNIAHGGSSVDLAIFSLHLAGISSILGAVNFITTVINMRPTGMSFDRMPLFVWAVVI FT TALLLLLSLPVLAGAITMLLTDRNLNTSF" XX SQ Sequence 577 BP; 174 A; 113 C; 92 G; 198 T; 0 other; atagtaggaa catctttaag cctactaatt cgaactgaac taggaaaccc cggctcatta 60 attggagatg atcaaattta taatgttatt gtaacagccc atgcatttat tataattttc 120 tttatagtaa tgcccattat aattggtgga tttggaaact ggttagtccc tctaatacta 180 ggtgccccag atatggcttt ccctcgaata aataatataa gtttttgatt actccctcct 240 tctttaactt tactaattat aagaagaatt gtagaaagag gggccggaac aggatgaact 300 gtgtaccctc ccttatcttc aaatattgcc catggaggat cttcagtaga tttagctatt 360 ttcagacttc acctagctgg aatctcctca attcttgggg cagtaaattt tattacaaca 420 gtaattaata tacgaccaac aggtataaga ttcgatcgaa tacccttatt tgtatgggcc 480 gtagtaatta ccgctttact cttactttta tccttaccag ttttagcagg agccatcact 540 atactcctaa ctgatcgaaa tttaaatact tcatttt 577 // ID LN889429; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889429; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Sipalinus gigas mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC1949 XX KW . XX OS Sipalinus gigas OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Dryophthorinae; Sipalinus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c251740b87a4fb62c68f1982ac045e8b. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Sipalinus gigas" FT /organelle="mitochondrion" FT /isolate="ARC1949" FT /mol_type="genomic DNA" FT /db_xref="taxon:1078824" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4I8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4I8" FT /protein_id="CUR50260.1" FT /translation="MVGTSLSLLIRAELGNPGSLIGDDQIYNVIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSMVEKGAGTGWTVYPP FT LSSNIAHGGASVDLAIFSLHMAGISSILGAINFISTTINMRPKGMTLDRLPLFVWAVTI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 171 A; 135 C; 89 G; 182 T; 0 other; atagtaggaa cttccttaag actattgatc cgagcagaac taggaaatcc tgggtcacta 60 attggagatg atcaaatcta taatgtaatt gtaaccgctc acgctttcat tataatcttc 120 ttcatagtaa tacctattat aatcggaggt tttggaaact gacttgttcc ccttatatta 180 ggagcccctg atatagcctt tccacgactt aacaacataa gattctgact tcttccaccg 240 tccttaactc tccttcttat aagaagaata gtagaaaagg gagcaggaac aggatgaact 300 gtatacccac cattatcatc caatatcgct cacggtggag cttcagtcga cctagctatt 360 ttcagtctcc atatagcagg gatttcttcc attctaggag ccattaactt catttcaaca 420 accatcaata tacgacctaa gggaataacc ctggaccgtc ttcctttatt tgtatgagca 480 gttacaatca ccgccattct cttacttctc tctcttcccg ttctagcagg tgcaatcact 540 atattattaa cagatcgaaa tattaataca tcatttt 577 // ID LN889430; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889430; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Psepholax cf. egerius/mastersii MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2065 XX KW . XX OS Psepholax cf. egerius/mastersii MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Psepholax. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 492a812c229ef657b8b79c513bd7db2f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Psepholax cf. egerius/mastersii MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2065" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738364" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZR5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZR5" FT /protein_id="CUR50261.1" FT /translation="MVGTSMSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGVSSILGAMNFISTVINMRPMGMKPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 175 A; 108 C; 88 G; 206 T; 0 other; atggtaggaa catctataag aatactgatt cgcaccgaat taggtaaccc tggaacatta 60 attggtaatg atcaaattta taactcaatt gtaactgccc atgcatttat tataattttt 120 tttatagtaa tgcctattat aattggagga tttggaaact gattagtgcc tttaatacta 180 ggagcccctg atatagcgtt tcctcggctc aataatataa gattctgact tttaccccca 240 tccttgactc ttttattaat aagaagaatt attgacaaag gagcaggaac tggttgaact 300 gtttatccac ccctatcctc taatattgcc catgaagggg cttcggtaga cctagcaatt 360 tttagacttc atatagctgg agtatcatcc atccttggtg caataaattt tatttctaca 420 gttattaata tacgacctat aggtataaaa cctgatcgaa tgcctttatt catttgagca 480 gtaaaaatta ctgctattct tctccttctt tcattacctg ttttagcagg tgctattacc 540 atactactaa ctgatcgaaa tattaatact tcatttt 577 // ID LN889431; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889431; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Enteles vigorsi mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2066 XX KW . XX OS Enteles vigorsii OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Enteles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d85f9b0587adc152175ebad6ca3b01dc. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Enteles vigorsii" FT /organelle="mitochondrion" FT /isolate="ARC2066" FT /mol_type="genomic DNA" FT /db_xref="taxon:1482114" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L412" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L412" FT /protein_id="CUR50262.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSSNVAHEGASVDLAIFSLHMAGVSSILGAMNFISTVINMRPAGMNPDRIPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 172 A; 127 C; 86 G; 192 T; 0 other; atagtcggaa cttcccttag aatacttatt cgaactgaat taggaaaccc cggaacttta 60 attggaaacg accaaatcta caattctatt gtaacagctc atgctttcat tataattttc 120 tttatagtaa tacctatcat aattgggggt ttcggaaact gattagtccc ccttatattg 180 ggagcccctg atatagcttt cccgcgactt aataatataa gattttgact tttacccccc 240 tcattaactc ttctattaat aagaagaatc gttgacaaag gagccggtac aggctgaact 300 gtctatccac ccctatcttc taatgtggca catgaaggag cttctgtaga tcttgctatt 360 tttaggcttc atatagcagg agtttcatca atcttaggcg ctataaattt tatctcaact 420 gttattaata tacgacccgc aggaataaac cctgaccgaa tccccctatt tatttgagca 480 gtaaaaatta cagcaatcct acttcttcta tctttacccg tcttagccgg agctattact 540 atactattaa cagatcgaaa tattaatacc tcatttt 577 // ID LN889432; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889432; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus humeralis mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2067 XX KW . XX OS Poropterus humeralis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9be26bb010c5dfa4c6e9b107e54506e0. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Poropterus humeralis" FT /organelle="mitochondrion" FT /isolate="ARC2067" FT /mol_type="genomic DNA" FT /db_xref="taxon:1742656" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZE8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZE8" FT /protein_id="CUR50263.1" FT /translation="MIGTSMSVLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGMSSILGAMNFISTIMNMRPTGMKLERMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 116 C; 80 G; 199 T; 0 other; ataattggta cttctataag agtattaatt cgtactgaat taggtaatcc tggaactcta 60 attggaaatg atcaaattta caactccatc gtaacagccc atgcctttat tataattttc 120 tttatagtta taccaattat aattggtgga tttggtaact gattagtccc acttatatta 180 ggagcccccg atatggcctt tcctcgacta aataatataa gattctgact cttaccccca 240 tcactaactc tacttttaat aagtagaatt attgacaaag gagcaggaac aggttgaaca 300 gtttatcctc ccttatcatc aaatgtagcc catgagggaa tttctgtaga tctagccatt 360 tttagactcc acatagcagg aatatcctct atcttaggag ccataaattt catttctacc 420 atcataaata tacgccctac tggtataaaa ctagaacgta tgccactatt tgtatgagca 480 gtaaaaatta cagctatttt actacttcta tcccttccag ttttagctgg cgctatcact 540 atattattaa cagatcgtaa tattaatact tcatttt 577 // ID LN889433; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889433; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Perissops ochreonotatus mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2068 XX KW . XX OS Perissops ochreonotatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Perissops. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b38d149386b7363acd67d01a132ff121. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Perissops ochreonotatus" FT /organelle="mitochondrion" FT /isolate="ARC2068" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738206" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L280" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L280" FT /protein_id="CUR50264.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSILGAMNFISTVMNMRPKGMNSDRMTLFTWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 172 A; 111 C; 80 G; 214 T; 0 other; atagtgggaa catccttaag aatattaatt cgtactgaat taggaaatcc cggaacatta 60 attggaaatg atcaaattta taattccatt gttacagccc atgcttttat tataattttc 120 ttcatagtta tacctattat aattggggga ttcggaaact gattaattcc tctcatatta 180 ggtgctcctg atatagcttt tcctcgactt aataatataa gattctgatt actccctcca 240 tcattaaccc ttcttcttat aagaagaatt gttgacaaag gtgcaggaac tggttgaaca 300 gtttaccccc ccttatcttc aaacattgcc catgaaggag cttctgttga tttagctatt 360 tttagtcttc atatagctgg aatttcctct atcttagggg ctataaattt tatttctaca 420 gttataaata tacgacccaa aggtataaat tctgatcgaa taaccttatt tacttgagct 480 gtaaaaatta ctgctattct ccttctttta tctctcccag ttttagcagg agctattacc 540 atactcctta ctgatcgaaa tatcaataca tcatttt 577 // ID LN889434; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889434; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eutyrhinus meditabundus mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2069 XX KW . XX OS Eutyrhinus meditabundus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eutyrhinus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 83223c348ade3bfa5828cd23a4771a65. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Eutyrhinus meditabundus" FT /organelle="mitochondrion" FT /isolate="ARC2069" FT /mol_type="genomic DNA" FT /db_xref="taxon:1482124" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1S3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1S3" FT /protein_id="CUR50265.1" FT /translation="MIGTSMSVLIRIELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRMNNLSFWLLPPSLTFLLMSSIVDKGVGTGWTVYPP FT LSSNLGHEGTSVDLAIFSLHMAGVSSILGAINFISTIINMRPQGMSLDRLPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 177 A; 108 C; 84 G; 208 T; 0 other; ataattggaa cctcaataag agttctgatt cgtattgaat taggaactcc tggaacttta 60 attggcaatg atcaaattta taactctatt gtaacagctc acgcttttat tataattttc 120 ttcatagtaa tgcctatcat aattggagga tttggtaatt gattaattcc cttaatatta 180 ggagcacctg atatagcatt ccctcgtatg aataatttaa gattttgact actcccccct 240 tctctaacct ttttactaat aagaagaatt gttgataaag gagtgggaac tggatgaaca 300 gtttaccctc cactatcttc aaatttagga catgaaggaa cctcagtaga cttagcaatt 360 ttcagactac atatagccgg agtttcatca attttaggag ctattaattt tatttccact 420 attattaata tacgacctca aggaatatcc cttgatcgcc ttcctctttt tgtgtgagca 480 gtaaaaatta ctgcaattct cctattactg tctcttcctg tactagcagg agctatcaca 540 atattattaa ccgatcgtaa tattaatact tcatttt 577 // ID LN889435; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889435; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Camptorhinus sp. ARC2070 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2070 XX KW . XX OS Camptorhinus sp. ARC2070 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Camptorhinus; unclassified Camptorhinus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 31adc5a26ac834d3a2e9a2e3339d1698. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Camptorhinus sp. ARC2070" FT /organelle="mitochondrion" FT /isolate="ARC2070" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736921" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1V9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1V9" FT /protein_id="CUR50266.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNLSFWLLPPSILFLLMSSIIDKGAGTGWTVYPP FT LSTNIAHEGASVDLAIFSLHMAGVSSILGAMNFISTIINMRPMGMNKDRMSLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 184 A; 98 C; 83 G; 212 T; 0 other; atagtaggaa catcattaag aatattaatt cgtacagaat taggaaatcc tggtagctta 60 attggaaatg atcaaattta taatactatt gtaactgccc atgcatttat tataattttt 120 ttcatagtta tacctatcat aatcggagga tttggaaatt gacttgttcc attaatatta 180 ggagctccag acatagcatt ccctcggtta aataatttaa gattttgatt attacctcct 240 tcaattcttt tcttattaat aagaagaatt attgataaag gagctggaac aggatgaaca 300 gtctacccac cattatcaac aaatattgct catgaaggag cttctgttga tttagctatt 360 ttcagccttc atatagcagg ggtgtcctca attcttggag ccataaattt tatttctact 420 attattaata tacgacctat aggaataaat aaagatcgta tatccctgtt tgtttgagct 480 gttaaaatta cagcaattct tcttcttctt tccctcccag tacttgcagg agcaatcact 540 atacttttaa ctgaccgtaa tattaataca tcttttt 577 // ID LN889436; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889436; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhadinomerus sp. ARC2071 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2071 XX KW . XX OS Rhadinomerus sp. ARC2071 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Aedemonini; Rhadinomerus; unclassified Rhadinomerus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 66ae57b018a86b2875348d796f380f67. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Rhadinomerus sp. ARC2071" FT /organelle="mitochondrion" FT /isolate="ARC2071" FT /mol_type="genomic DNA" FT /db_xref="taxon:1736947" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4A4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4A4" FT /protein_id="CUR50267.1" FT /translation="MVGTSLSMLIRTELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTFLLISSIVDKGAGTGWTVYPP FT LSTNISHEGPSVDLAIFSLHMAGISSILGAINFISTIFNMHPKGMKPERLSLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 172 A; 113 C; 79 G; 213 T; 0 other; atagtcggca cttccttaag tatacttatc cgaactgaat taggaactcc tggaagatta 60 attggcgatg accaaatcta taatacaatt gtcacagctc atgcttttat tataattttt 120 tttatggtaa taccaattat aattggagga tttggaaatt gacttgtacc tctaatactt 180 ggtgcacctg atatagcctt cccccgtcta aataatataa gattttgact tcttcctccc 240 tcattaacct ttcttttaat tagaagaatt gtagataaag gagcaggaac cggatgaact 300 gtctaccctc ctctctcaac caatatctct cacgaaggac cttcagtaga tttagctatt 360 tttagacttc acatagctgg aatttcttct attttaggag caattaattt tatctctaca 420 atttttaata tacatcccaa aggaataaaa ccagaacgtt tatctctttt tgtatgagca 480 gtaaagatta ctgctatttt acttcttctt tctttacctg ttctagctgg tgctattact 540 atattattaa ccgatcgaaa tatcaatacc tcatttt 577 // ID LN889437; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889437; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Car cf. condensatus MB-2015 MB-2015mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2073 XX KW . XX OS Car cf. condensatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Caridae; Car. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bce97548ee62fac2aba6845b8f93e73b. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Car cf. condensatus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2073" FT /mol_type="genomic DNA" FT /db_xref="taxon:1738343" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ69" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ69" FT /protein_id="CUR50268.1" FT /translation="MVGTSLSILIRTELGTPGSLIGNDQIYNVIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLMLLLISSIVENGAGTGWTVYPP FT LSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFISTIINMRPYGMNSDSMPLFVWAVGI FT TALLLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 178 A; 91 C; 86 G; 222 T; 0 other; atagtaggaa catcattaag aatcttaatt cgaactgaat taggaactcc tggttcatta 60 attggaaatg accaaattta taatgtaatt gtaactgccc atgcttttat tataattttt 120 tttatagtta tacctattat aattggagga ttcggaaatt gacttgtacc tctaatatta 180 ggagctcctg atatagcttt cccacgaata aataatataa gattttgact cctgcctcct 240 tcattaatac ttcttttaat tagaagaatt gttgaaaatg gggcaggaac tgggtgaaca 300 gtttacccac ccttatcatc aaatattgct catagaggat catcagtaga cttagcaatt 360 tttagccttc atctagcagg tatttcttct attttaggag cagtaaattt tatttctaca 420 attattaata tacggcctta tggtataaat tctgatagaa tacctttatt tgtatgagca 480 gtagggatta ctgctttact acttttatta tctttacctg ttttagcagg agctattact 540 atacttttaa ctgatcgaaa tatcaatact tcttttt 577 // ID LN889438; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889438; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Rhynchites auratus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2098 XX KW . XX OS Rhynchites auratus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Attelabidae; OC Rhynchitinae; Rhynchites. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bfffaf1fe801fa6034cd215de84b38c6. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Rhynchites auratus" FT /organelle="mitochondrion" FT /isolate="ARC2098" FT /mol_type="genomic DNA" FT /db_xref="taxon:614235" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1V8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1V8" FT /protein_id="CUR50269.1" FT /translation="XVGTSLSLLIRAELGNPGYLIGDDQIYNVMVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLITSSIVESGAGTGWTVYPP FT LSSNIAHGGSSVDLAIFSLHLAGISSILGAVNFIXTVINMXPTGMSFDXMSLXVWAVAI FT TALLLLLSLPVXXGAXTMXLTDXNINTTF" XX SQ Sequence 577 BP; 170 A; 105 C; 92 G; 198 T; 12 other; kwagtaggaa catctttaag actactaatc cgagcagaat taggaaatcc agggtatctt 60 attggagatg atcaaattta caatgttatg gttactgccc atgcattcat tataattttc 120 tttatagtta taccaattat aattggagga ttcggaaatt gactagtccc tttaatatta 180 ggagccccag acatagcatt cccccgaata aataacataa gattctgact cctgcctcct 240 tcattaagac ttttaattac tagaagaatt gtagaaagag gagcaggaac tgggtgaaca 300 gtatatcctc ctctatcatc caatattgct catggtggtt cttcagttga tttagcaatc 360 tttagtctac atttagcagg aatttcctca attcttgggg ctgttaattt tatttstact 420 gttatcaaca tasgacctac aggaatatcc tttgatygaa tatcgttakt tgtatgagca 480 gttgctatta cagctctcct tcttctttta tcccttccag ttstygstgg agcaawtact 540 atasttttaa cagatygaaa tatcaataca accttct 577 // ID LN889439; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889439; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Coniferocryptus tamanukii mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2114 XX KW . XX OS Coniferocryptus tamanukii OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Coniferocryptus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fd98e3611d3fedcf1094128db58ff49b. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Coniferocryptus tamanukii" FT /organelle="mitochondrion" FT /isolate="ARC2114" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738234" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L207" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L207" FT /protein_id="CUR50270.1" FT /translation="MIGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSTNIAHEGASIDLAIFSLHMAGISSILGAMNFISTIINMHPTGMNLDQLPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 189 A; 104 C; 78 G; 206 T; 0 other; ataattggaa catcactaag aatattaatt cgaacagaat taggtaatcc cggaagatta 60 attggtaatg atcaaattta taattcaatt gtaacagctc atgccttcat tataattttt 120 tttatagtaa taccaatcat aattggggga tttggaaact gattagttcc attaatatta 180 ggcgcacccg acatagcttt cccacgactt aataacataa gattctgatt attgcccccc 240 tctctcactc ttttattaat aagtagaatt attgataaag gagcaggaac tggatgaaca 300 gtctacccac cactttcaac caatattgct catgaaggag cttctattga tttagcaatc 360 ttcagacttc atatagcagg tatttcttct attcttgggg caataaattt tatttctaca 420 attattaata tacatccaac aggaataaat ttagaccaac ttcctttatt tgtttgagca 480 gtgaaaatta ctgccattct tttacttctt tcccttccag tattagcagg agctattact 540 atattattaa cagatcgaaa tattaataca tcttttt 577 // ID LN889440; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889440; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Scelodolichus cf. lineithorax MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2162 XX KW . XX OS Scelodolichus cf. lineithorax MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Scelodolichus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 60bf0682020f7e30225d79928d36ffb2. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Scelodolichus cf. lineithorax MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2162" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738366" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0G3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0G3" FT /protein_id="CUR50271.1" FT /translation="MVGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDNGAGTGWTVYPP FT LSSNIAHEGVSVDLAIFSLHMAGISSILGAMNFISTMINMRPMGMKPDQMPXXIWSVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 176 A; 116 C; 73 G; 210 T; 2 other; atagtaggaa cctctttaag aatattaatt cgaactgaat taggcacccc tggaacctta 60 attggaaatg atcaaatcta taattccatt gtcacagctc acgcttttat tataattttt 120 tttatagtta tacccatcat aattggtggc tttggaaatt gattaattcc tttaatatta 180 ggtgcaccag atatagcatt ccctcgactt aataatataa gattttgact tcttccccct 240 tcattaactc ttcttttaat aagcagaatc attgataacg gagcaggaac aggatgaact 300 gtataccccc ctctatcctc aaatattgca catgaaggag tttcagtaga tctagccatt 360 tttagtcttc atatagcagg tatctcctcc attttaggag ctataaattt tatttctact 420 ataattaata tacgcccaat aggaataaaa cctgatcaaa taccccycyt tatttgatcc 480 gttaaaatta ctgctattct tctacttcta tctttacctg ttctagccgg agctattact 540 atacttctaa ctgatcgaaa tattaatact tcttttt 577 // ID LN889441; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889441; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Crisius ventralis mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2165 XX KW . XX OS Crisius ventralis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Crisius. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fc713aab5b9d6551d9cba7ae0644d1a5. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Crisius ventralis" FT /organelle="mitochondrion" FT /isolate="ARC2165" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738237" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1V7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1V7" FT /protein_id="CUR50272.1" FT /translation="MVGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGVSSILGAMNFISTVINMRPMGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 178 A; 121 C; 80 G; 198 T; 0 other; atagttggaa cttccctaag aatactcatt cgtaccgaat taggtacccc aggaacttta 60 attggaaatg accaaattta taattctatc gtcacagcac acgcttttat tataattttt 120 tttatagtta taccaattat aattgggggt tttggaaact gattaatccc tctaatatta 180 ggtgcaccag atatagcctt ccctcgatta aataatataa gattttgact cctacccccc 240 tcacttactc ttctattaat aagtagtatt attgataaag gagcaggaac aggttgaact 300 gtctatcccc ccttatcctc taatattgct catgaaggaa tttcagttga tctcgcaatc 360 tttagccttc acatagccgg agtttcatcc attttagggg ctataaattt tatttcaact 420 gttattaata tacgcccaat aggaataaac ccagaccgaa taccactatt tatttgagca 480 gttaaaatca cagcaatttt actacttcta tctctcccag ttttggcggg agctatcaca 540 atacttttaa ccgaccgaaa tattaataca tcatttt 577 // ID LN889442; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889442; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paromalia setiger mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2166 XX KW . XX OS Paromalia setiger OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Paromalia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4379368eab55b6498c2f3ee5929711ea. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Paromalia setiger" FT /organelle="mitochondrion" FT /isolate="ARC2166" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738273" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ13" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ13" FT /protein_id="CUR50273.1" FT /translation="MIGTSLSLIIRMELGTPGSLISNDQMYNSIVTAHAFIMIFFMVMP FT ILIGGFGNWLIPLMLGAPDMAFPRLNNLSFWLLPPSLTLLLMSNFIENGVGTGWTVYPP FT LSANISHEGISVDLAIFSLHMAGISSILGAMNFISTIFNMHPKGMFSDRMSLFIWAIKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 175 A; 96 C; 71 G; 235 T; 0 other; ataattggaa cttccctaag attaattatt cgtatagaat taggaacccc tggtagttta 60 attagaaacg atcaaatata taactctatt gtaactgctc atgcttttat tataattttt 120 tttatagtta taccaatttt aattggaggt tttggaaatt gattaattcc attaatacta 180 ggagcccctg atatagcctt tcctcgctta aataatctaa gattttgatt actacctcct 240 tccctcacac ttttattaat aagtaatttt attgaaaatg gtgttggaac aggttgaaca 300 gtttaccctc ctttatctgc taatatctct catgaaggga tttctgttga tctcgccatt 360 tttagtctac atatagcagg aatctcatct attttaggag ctataaattt tatttcaact 420 atttttaata tacaccctaa aggaatattt tctgatcgta tatctttatt tatttgagct 480 attaaaatta ctgctatttt actcctttta tctttaccag tacttgcagg agcaatcaca 540 atacttttaa cagatcgaaa tattaatact tcttttt 577 // ID LN889443; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889443; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Synacalles dorsalis mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2168 XX KW . XX OS Synacalles dorsalis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Synacalles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8c4135dbab7a13e8efbb3062050ae288. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Synacalles dorsalis" FT /organelle="mitochondrion" FT /isolate="ARC2168" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738285" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L6C5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L6C5" FT /protein_id="CUR50274.1" FT /translation="MVGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIMNSGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSILGAMNFISTIINMRPKGMNSDLMPPFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 112 C; 76 G; 210 T; 0 other; atagtaggaa cttctcttag tatactaatt cgtactgaat taggtacccc tgggacttta 60 attggaaatg atcaaatcta taactctatt gttactgccc acgctttcat tataattttt 120 tttatagtaa taccaattat aattggaggt tttggaaatt gattaatccc actaatactt 180 ggagccccag atatagcttt tcctcgactt aataatataa gattttgatt actaccccct 240 tcattaacac ttttactaat aagaagaatt ataaatagcg gcgccggaac aggttgaaca 300 gtttatccac ctctatcatc taatattgcc catgaaggag catcagttga tttagctatt 360 tttagactcc atatagctgg tatttcttct atcttaggtg caataaattt tatctcaact 420 attattaata tacgacctaa aggaataaac tcagacttaa tacctccctt tatttgagct 480 gtaaaaatta ctgcaatttt attactttta tctctcccgg tcctagctgg tgctatcaca 540 atactcttaa ctgatcgaaa tattaacacc tcatttt 577 // ID LN889444; SV 1; linear; genomic DNA; STD; INV; 565 BP. XX AC LN889444; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Agacalles cf. formosus MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2171 XX KW . XX OS Agacalles cf. formosus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Agacalles. OG Mitochondrion XX RN [1] RP 1-565 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; b5a2feb89bf058f9c99ae3b7abda8f53. XX FH Key Location/Qualifiers FH FT source 1..565 FT /organism="Agacalles cf. formosus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2171" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738339" FT CDS <1..>565 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ84" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ84" FT /protein_id="CUR50275.1" FT /translation="SLSMLIRTELGNPGMLIGNDQIYNSIVTAHAFIMIFFMVMPILIG FT GFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIINNGAGTGWTVYPPLSAN FT IAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMYPKGMKSEQMPLFIWAVKITAIL FT LILSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 565 BP; 171 A; 98 C; 76 G; 220 T; 0 other; tctttaagaa tattaattcg tacagaatta ggaaatcccg ggatattaat tggaaacgac 60 caaatttata actctattgt tactgcccat gcttttatta taattttttt catagttata 120 cctattttaa ttggtggttt tggtaattgg ttaattcctc ttatattagg agccccagat 180 atggcctttc ctcgtcttaa taatataaga ttttgactcc tccccccttc tttaacttta 240 ttattaataa gaagtattat taataatggt gcaggaacag ggtgaactgt ttaccccccc 300 ttatctgcga acattgctca tgaaggagcc tctgtagatc tagctatttt tagacttcat 360 atagccggaa tttcctcaat cttaggagca ataaatttta tttctactgt aattaatata 420 tacccaaaag gaataaaatc agaacaaata cctcttttta tttgagctgt taaaattaca 480 gcaattcttt taattttatc tttacctgtt cttgcaggag caattactat acttttaact 540 gatcgaaata ttaatacttc ttttt 565 // ID LN889445; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889445; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Zeacalles incultus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2174 XX KW . XX OS Zeacalles incultus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Zeacalles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 684b1b7d3ec048ff854f5234874774f0. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Zeacalles incultus" FT /organelle="mitochondrion" FT /isolate="ARC2174" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738289" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4K4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4K4" FT /protein_id="CUR50276.1" FT /translation="MLGTSLSMLIRSELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLTGNIVDKGTGTGWTVYPP FT LSANIAHEGISVDLAIFSLHMAGISSILGAMNFISTIMNMRPKGMTSDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNVNTSF" XX SQ Sequence 577 BP; 189 A; 108 C; 79 G; 201 T; 0 other; atattaggaa cttctttaag aatacttatt cgatcagaac ttggaaaccc aggaaccttg 60 attggaaacg atcaaattta taactcaatt gttactgctc atgcttttat tataattttt 120 tttatagtaa taccaatcat aattggtgga ttcggtaact gattaatccc actaatactt 180 ggagcccctg atatagcctt ccctcgacta aataatataa gattttgatt attaccacca 240 tctttaactc tcctattaac aggtaatatt gtagataaag gaacaggtac tggttgaacg 300 gtatatcctc ccttatcagc taatattgct catgagggaa tttcagtaga tttagcaatt 360 tttagattac atatagctgg aatttcttct atcttagggg caataaactt tatttctaca 420 atcataaata tacgacccaa aggaataacc tcagaccgaa tacctttatt tatttgagca 480 gtaaaaatca cagcaatttt attactttta tctctacccg ttcttgcagg agccatcact 540 atactcttaa cagaccgaaa tgtaaatact tcatttt 577 // ID LN889446; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889446; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Clypeolus cf. ingens MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2175 XX KW . XX OS Clypeolus cf. ingens MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Clypeolus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 48311163089f66b0bd4279e4951036fa. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Clypeolus cf. ingens MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2175" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1743267" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZS4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZS4" FT /protein_id="CUR50277.1" FT /translation="MIGTSLSMIIRTELGTPGALINNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSITDKGAGTGWTVYPP FT LSSNITHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPAGMSHDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 117 C; 81 G; 200 T; 0 other; ataattggaa cttccttaag aataattatc cgaactgaat tagggacccc tggagcatta 60 attaataatg atcaaattta taactcaatt gttacagccc acgcatttat tataattttt 120 tttatagtta tacctattat aatcggtgga tttggaaatt gacttattcc cttaatatta 180 ggggccccag atatagcctt ccctcgacta aacaacataa gattttgact tctacctccc 240 tcacttaccc ttttactaat aagaagaatt actgataaag gagctgggac aggttgaact 300 gtttaccccc ctttatcttc caatattacc catgagggag cctcagtaga cctagcaatc 360 tttagattac atatggctgg aatctcctct attcttggag ctataaactt tatttctaca 420 gtaatcaata tacgaccagc tgggataagt catgatcgaa tacctctttt tatctgagca 480 gtaaaaatta ctgcaatctt attactttta tccttacccg ttttagcagg agctatcact 540 atattattaa cagatcgaaa tattaatacc tcttttt 577 // ID LN889447; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889447; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Crisius fasciculatus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2179 XX KW . XX OS Crisius fasciculatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Crisius. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; deff282932848b2aa3080d296009f154. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Crisius fasciculatus" FT /organelle="mitochondrion" FT /isolate="ARC2179" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738236" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L432" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L432" FT /protein_id="CUR50278.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNVAHEGISVDLAIFSLHMAGISSILGAMNFISTIINMRPMGMNPDRMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 185 A; 109 C; 80 G; 203 T; 0 other; atagtaggaa cttctttaag aatactaatt cgtactgaat taggaaaccc aggtacctta 60 attggtaatg atcaaatcta taattctatc gttacagccc atgctttcat tataattttt 120 tttatagtaa taccaattat aattggagga ttcggaaatt gattagtccc acttatactt 180 ggagcccctg atatagcttt cccacgatta aataatataa gattttgact actcccacct 240 tcactaaccc ttcttctaat aagaagaatt attgataaag gagcaggaac aggatgaact 300 gtatatcccc ccctttcttc aaatgtagct cacgaaggta tctcagtaga cttagcaatt 360 tttagacttc atatagccgg aatttctagt attttaggag ctataaattt tatctctaca 420 attatcaata tacgaccaat gggtataaac cctgatcgaa taccattatt tgtatgagcc 480 gttaaaatca cagctattct tttacttcta tctttaccgg ttttagctgg agctattact 540 atacttttaa ctgaccgaaa tattaataca tcatttt 577 // ID LN889448; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889448; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Dermothrius farinosus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2182 XX KW . XX OS Dermothrius farinosus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Dermothrius. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e70c4d8a4a3f6c5b85dd17c7b332626f. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Dermothrius farinosus" FT /organelle="mitochondrion" FT /isolate="ARC2182" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738245" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZG4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZG4" FT /protein_id="CUR50279.1" FT /translation="MVGTSMSMMIRTELGNPGSLIGNDQIYNSIVTAHAFVMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGVSSILGAMNFISTVFNMRPSGMDPDRITLFIWAVKI FT TAVLLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 109 C; 85 G; 201 T; 0 other; atagtaggaa cttctataag aataataatt cgaacagaat taggaaatcc aggaagacta 60 attggaaatg accaaatcta taattcaatt gtaactgccc atgcctttgt tataattttt 120 tttatagtaa tacctattat aattggagga tttgggaatt gattgatccc cctaatatta 180 ggagcccctg atatagcttt ccctcgcctt aataatataa gattttgatt gcttccccct 240 tctttaaccc tattattaat aagaagaatt attgataaag gagctggaac aggatgaaca 300 gtttaccccc ctttatcctc aaatattgcc cacgaaggaa tctccgttga tttagctatt 360 tttagattac atatagcagg agtttcttca attttaggtg ccataaattt catttcaaca 420 gtttttaata tacgcccctc aggaatagac ccagaccgaa ttactctttt catttgagca 480 gttaaaatta cagcagtttt actattactt tctcttcctg ttttagcagg ggccattaca 540 atacttctta ccgaccgaaa tattaatacc agatttt 577 // ID LN889449; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889449; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Crooktacalles abruptus mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2183 XX KW . XX OS Crooktacalles abruptus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Crooktacalles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 64994c345c9123cf21021883b2d3978b. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Crooktacalles abruptus" FT /organelle="mitochondrion" FT /isolate="ARC2183" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738239" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L298" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L298" FT /protein_id="CUR50280.1" FT /translation="MLGTSLSMLIRTELGNPGIFIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLAPLMLGAPDMAFPRLNNLSFWLLPPSLIFLLMSSIIDKGAGTGWTVYPP FT LSANIAHEGPSVDLAIFSLHMAGASSILGAMNFISTILNLRPTGMNSEQMPLFIWAVKI FT TAILLLLSLPVLXGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 182 A; 123 C; 83 G; 188 T; 1 other; atattaggga cctccctaag aatattaatt cgaaccgaac taggaaaccc tggaattttc 60 atcggaaacg accaaattta taatactatt gtgactgcac atgcctttat tataatcttt 120 tttatagtta tacctatcat aattggggga ttcggaaatt gacttgcacc tttaatactt 180 ggagcccctg atatagcttt ccctcgactt aataatctaa gattttgatt actcccccca 240 agtttaattt ttttactaat aagaagaatt attgataaag gagctggaac agggtgaact 300 gtttatcccc ctttatcagc taatatcgcc catgaagggc cctcagttga tttagcaatc 360 tttagattgc atatggcagg agcctcatca atcctagggg ccataaattt tatttcaaca 420 attttaaatt tacgaccaac aggtataaac tcagaacaaa tacctctttt catctgagct 480 gtaaaaatta cagccatcct actactacta tcccttcctg tcctascagg agcaatcaca 540 atacttttaa ctgaccgaaa tattaatact tcattct 577 // ID LN889450; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889450; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Trinodicalles cf. cristatus/mimus MB-2015 mitochondrial partial COI gene DE for cytochrome oxidase subunit 1, isolate ARC2185 XX KW . XX OS Trinodicalles cf. cristatus/mimus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Trinodicalles. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1a9f9cd0b16d3b91f1cad1e0abdaa556. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Trinodicalles cf. cristatus/mimus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2185" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738370" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1T8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1T8" FT /protein_id="CUR50281.1" FT /translation="MVGTSLSMLIRTELGAPNTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSVTLLLMSSIIDNGAGTGWTVYPP FT LSSNYAHEGISVDLAIFSLHMAGISSILGAMNFISTVMNMRPKGMNPDRMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 172 A; 122 C; 86 G; 197 T; 0 other; atagtcggaa catctctaag aatattgatc cggactgaat tgggggcccc caatacatta 60 attggaaatg atcaaattta taattccatt gttacagctc atgcctttat tataattttt 120 tttatagtta tgccaattat aattggcgga tttggaaatt gattaattcc tctcatacta 180 ggagccccgg atatagcctt cccacgacta aacaatataa gattttgact tctccccccc 240 tcagtaactc ttctattaat aagaagtatt attgataacg gggcagggac gggttgaact 300 gtgtacccac cattatcttc caattatgca catgaaggaa tctctgtaga tttagctatc 360 tttagcctac acatagccgg gatctcttca attttaggag ctataaactt tatttctaca 420 gtaataaata tacgccctaa aggtataaac cctgaccgca tacctttatt tatttgagcc 480 gttaaaatta cagctatcct attacttctt tcccttccag ttcttgcagg agctattaca 540 atacttttaa ctgatcgaaa tatcaatacc tcctttt 577 // ID LN889451; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889451; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini cf. Kirschia sp. ARC2346 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2346 XX KW . XX OS Cryptorhynchini cf. Kirschia sp. ARC2346 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1db41f55885ec8323d5a30842cbdfa28. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchini cf. Kirschia sp. ARC2346" FT /organelle="mitochondrion" FT /isolate="ARC2346" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1742670" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1X9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1X9" FT /protein_id="CUR50282.1" FT /translation="MVGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNLSFWLLPPSLTLLIMSSIIDKGAGTGWTVYPP FT LAANIAHEGASVDLAIFSLHMAGISSILGAINFISTVINMHPMGMKPDQYPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 112 C; 80 G; 206 T; 0 other; atagtaggaa catcactcag aatattaatt cgaacagaat taggaactcc tggaactcta 60 attggaaatg atcaaattta taattctatt gtaactgctc atgcttttat tataattttt 120 tttatagtaa tacccattat aatcggcgga ttcgggaact gattagtgcc tcttatacta 180 ggagctcctg atatagcttt ccctcgctta aataatttaa gattttgact ccttcctccc 240 tccttaaccc ttttaattat atcaagaatt attgataaag gagcaggaac aggttgaaca 300 gtttatccac ctttagcagc taatattgca catgaaggag cctccgttga tttagccatt 360 tttagattac atatagcagg aatttcttcc atcttaggag caattaactt tatttccact 420 gtaattaata tacatccaat aggaataaaa cctgatcaat accctttatt tgtctgagca 480 gttaaaatca ctgctattct attgcttctt tctcttccag tattagctgg agcaattacc 540 atactcctta cagatcgaaa tattaatacc tcatttt 577 // ID LN889452; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889452; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Platytenes varius mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2363 XX KW . XX OS Platytenes varius OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Platytenes. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 57414cf3090ccf54fc7bb417f6c208be. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Platytenes varius" FT /organelle="mitochondrion" FT /isolate="ARC2363" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738275" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4B5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4B5" FT /protein_id="CUR50283.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT MLIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSILGAMNFISTIINMRSPGMSPDRMSLFIWAVNI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 167 A; 122 C; 86 G; 202 T; 0 other; atagtcggaa catcattaag aatattaatt cgaactgaac taggaaaccc tggcactctc 60 attggaaatg atcaaattta taactcaatc gttactgctc atgcttttat tataattttt 120 tttatagtaa tacctatatt aattggagga tttggaaact gattagtgcc tctaatatta 180 ggagcccctg acatagcctt cccacgactt aataatataa gattctgact tctccccccc 240 tctctcactc ttcttttaat aagaagaatt gttgataagg gggcaggaac aggatgaact 300 gtctatcccc ccctttcctc taatatcgcc catgaaggag cctctgttga cctggctatc 360 tttagacttc atatagctgg tatcagatca attctagggg ctataaattt tatttcaaca 420 atcattaata tacgatctcc ggggataagc cccgatcgaa tatctttatt tatctgagct 480 gttaatatta ctgcaatttt actactttta tcccttcctg ttctagccgg agctattaca 540 atattactta cagatcgtaa tattaatact tcctttt 577 // ID LN889453; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889453; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus lapathi mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2551 XX KW . XX OS Cryptorhynchus lapathi (poplar-and-willow borer) OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5e885c5c2226cf99a4de77ddc45f357c. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchus lapathi" FT /organelle="mitochondrion" FT /isolate="ARC2551" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:201897" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ82" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ82" FT /protein_id="CUR50284.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGXIGNXXXPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSTNIAHEGASVDLAILSLHMAGISSILGAMNFISTVANMHPTGMKLDQLPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNVNTSF" XX SQ Sequence 577 BP; 186 A; 120 C; 80 G; 184 T; 7 other; atagtaggaa catccctaag aatactcatt cgaacagaat taggtaaccc aggaagatta 60 atcggtaatg accaaatcta taattccatt gttacagctc atgcttttat cataattttc 120 tttatagtaa taccaatcat aatcggarga attggaaayk rwtwatyccc tttaatatta 180 ggagccccag atatagcatt ccctcgcctt aataatataa gattttgact tttacccccc 240 tcactcactc ttctactaat aagaagtatt atcgataaag gagcaggaac aggatgaact 300 gtttacccac ccttatcgac taatattgcc catgaaggag cttctgtaga tctagctatt 360 cttagtcttc atatagcagg aatttcttct attctagggg caataaattt catttctaca 420 gtagctaata tacaccccac aggaataaaa ttagaccaac tacccctttt tgtgtgagct 480 gttaaaatta cagcaatttt actcttacta tctctaccag tattagcagg ggctatcaca 540 atacttttaa cagatcgaaa tgtcaatact tctttct 577 // ID LN889454; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889454; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Gasterocercus depressirostris mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2552 XX KW . XX OS Gasterocercus depressirostris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Gasterocercus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3a6abe642341a853e66ddede6ec36b2d. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Gasterocercus depressirostris" FT /organelle="mitochondrion" FT /isolate="ARC2552" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:201926" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1X8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1X8" FT /protein_id="CUR50285.1" FT /translation="TVGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFVMIFFMVMP FT ILIGGFGNWLVPXMLGAPDMAFPRLNNMSFWLLPPSLTLLIMSNFVDSGVGTGWTVYPP FT LSSNITHEGASVDLAIFSLHMAGISSILGAINFISTILNMRPTGMKPDQVTLFAWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 164 A; 120 C; 82 G; 200 T; 11 other; accgtaggaa cctccctaag aatactaatt cgtaccgaac taggaactcc cggaacctta 60 attggtaacg atcaaattta taaytctatc gtaacygccc acgcctttgt tataattttt 120 tttatagtta taccaatttt aattggggga tttggtaact gacttgtccc tttmatacta 180 ggagctcctg atatagcrtt ccctcgcctt aacaatataa gattttgact tttacctcct 240 tcattaactc ttctaatcat aagaaatttt gttgactcag gggtagggac tggatgaaca 300 gtrtayccac ctttrtctag aaatatyact catgaaggtg cctctgttga tctagcaatt 360 tttagycttc atatagcagg tatctcrtcc atcctrggag ctattaattt tatctctaca 420 atcttaaata tacgacctac cggaataaag ccagatcaag taactttatt tgcttgagca 480 gttaaaatta ctgctattct acttttatta tctctaccag tactagcagg agcaattact 540 atacttctta ccgaccgcaa tattaatact tcttttt 577 // ID LN889455; SV 1; linear; genomic DNA; STD; INV; 571 BP. XX AC LN889455; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alcidodes elegans mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2555 XX KW . XX OS Alcidodes elegans OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Alcidinae; Alcidodes. OG Mitochondrion XX RN [1] RP 1-571 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 736824e22329447b8e29319694659f28. XX FH Key Location/Qualifiers FH FT source 1..571 FT /organism="Alcidodes elegans" FT /organelle="mitochondrion" FT /isolate="ARC2555" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738163" FT CDS <1..>571 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L222" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L222" FT /protein_id="CUR50286.1" FT /translation="MIGTSLSIIIRIELGNPGSFIGNDQVYNPIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLLFLLMSMLAGKGVGTGWTVYPP FT LSTNLGHSGPAVDMAIFSLHMAGVSSILGAINFISTMANMRPMKMEQMPLFSWAINITT FT ILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 571 BP; 181 A; 107 C; 79 G; 204 T; 0 other; ataattggaa cttccctcag aatcattatt cgtattgaac taggaaaccc tggaagattc 60 attggaaatg atcaagtata caatccaatt gttactgctc atgcatttat tataattttt 120 tttatagtaa taccaattat aattggagga tttgggaact gattagttcc tcttatatta 180 ggagcacccg atatagcttt cccccgactt aataatataa gattttgact tctccctcct 240 tctttacttt ttttactcat aagaatatta gctggaaaag gtgtaggaac tggttgaaca 300 gtttatcccc ccctatcaac aaatctcggt catagaggac ctgcagtaga tatagcaatt 360 tttagattac atatagcagg ggtatcctca attttaggtg ctattaattt catttctaca 420 atagcaaata tacgacctat aaagatagaa caaatacccc tattttcatg agcaatcaat 480 attactacaa ttttacttct tctttcctta ccagttcttg ctggagcaat cactatactt 540 ttaacagatc gaaatattaa tacatctttt t 571 // ID LN889456; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889456; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Peribleptus dealbatus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2556 XX KW . XX OS Peribleptus dealbatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Paipalesomini; Peribleptus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; db1ba1e2c9c8ec60b80a401c04e27c62. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Peribleptus dealbatus" FT /organelle="mitochondrion" FT /isolate="ARC2556" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1482164" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0I1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0I1" FT /protein_id="CUR50287.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTFLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGTSVDLAIFSLHMAGVSSILGAMNFISTVINMRPMGMNMDKITLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 194 A; 95 C; 80 G; 208 T; 0 other; atagttggaa catctttaag aatattaatt cgaactgaat taggtaatcc aggtagatta 60 attggtgatg atcaaattta taatactatt gtaacagctc atgcctttat tataattttt 120 tttatagtaa taccaattat aattggagga tttggaaact gattagttcc attaatatta 180 ggagccccag atatagcatt ccctcgacta aataatataa gattttggct acttccacct 240 tcattaacct ttttactaat aagaagaatt attgataaag gagcaggcac tggatgaaca 300 gtttatcccc cactatcatc taatattgca catgaaggaa cttcagtaga tttagctatt 360 tttagattac acatagcagg tgtttcctct atcctaggag ctataaactt tatctctaca 420 gtaattaata tacgtcctat aggaataaat atagataaaa ttacattatt tatctgagct 480 gtaaaaatta ctgcaattct tctcctcctt tccttacctg tattagcagg tgcgatcact 540 atattattaa cagatcgtaa tattaataca tcctttt 577 // ID LN889457; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889457; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Aclees indignus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2557 XX KW . XX OS Aclees indignus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Aclees. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 877fd294719d1517c1b529baad7e2d08. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Aclees indignus" FT /organelle="mitochondrion" FT /isolate="ARC2557" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738218" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Y1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Y1" FT /protein_id="CUR50288.1" FT /translation="TVGTSLSMLIRAELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSILGAINFISTIINMKSPGMKPEQMSLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 179 A; 103 C; 85 G; 210 T; 0 other; accgtaggaa cttctttaag aatgctaatt cgagcagaat taggaaaccc aggaagatta 60 attggaaatg atcaaattta taatactatt gttacagccc atgcttttat tataattttc 120 tttatagtta taccaattat aattggggga tttggaaact gactagtacc tttaatactt 180 ggggctccag acatagcttt cccacgactt aataatataa gattttgact tctaccccct 240 tctttaactc ttttactaat aagaagaatt attgataaag gggcaggaac agggtgaact 300 gtttatccac cactttcttc taatattgct catgaaggag cttctgttga cttagctatt 360 tttagtcttc atatagcagg aatttcctca attcttgggg caatcaattt tatttcaact 420 attattaata taaagtctcc aggtataaaa ccagaacaaa tatctctatt tatttgagct 480 gtaaaaatta cggctattct tcttctttta tctcttcctg ttcttgcagg agccatcact 540 atgctattaa cagatcgaaa tattaacaca tcttttt 577 // ID LN889458; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889458; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantoxystus rubricollis mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2558 XX KW . XX OS Pantoxystus rubricollis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Cleogonini; Pantoxystus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 456f5158ccd797cc3e41a672f79dcc2d. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Pantoxystus rubricollis" FT /organelle="mitochondrion" FT /isolate="ARC2558" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738269" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZF1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZF1" FT /protein_id="CUR50289.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGVSSILGAVNFISTVMNMRPSGMKPDQMTLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 184 A; 97 C; 81 G; 215 T; 0 other; atagtaggaa cttcactaag aatattaatt cgaactgaac taggaaatcc tgggagttta 60 attggggatg atcaaattta taatactatt gtaactgctc atgcttttat tataattttt 120 tttatagtaa tacctatcat aattggtgga tttggaaact gactaattcc actaatatta 180 ggagctcctg atatagcttt ccctcgactt aataatataa gattttgact tttacctccc 240 tccttaagat tactattaat aagatctatt attgataaag gagctggtac tggctgaaca 300 gtttaccccc ctttatcatc aaatattgct catgaaggtg cttctgtaga tcttgctatt 360 tttagactcc atatagcagg agtatcctca attttaggag cagtaaattt tatttctaca 420 gttataaata tacgaccttc aggaataaaa cctgatcaaa taactttatt tatctgagcc 480 gtaaaaatta cagcaattct tcttctttta tcattacctg ttcttgcagg agctattact 540 atattattaa ctgaccgaaa tattaataca tcatttt 577 // ID LN889459; SV 1; linear; genomic DNA; STD; INV; 571 BP. XX AC LN889459; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Neolaemosaccus cf. petulans MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2560 XX KW . XX OS Neolaemosaccus cf. petulans MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Mesoptiliini; Neolaemosaccus. OG Mitochondrion XX RN [1] RP 1-571 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9fc726a7ac4f77bbc74fcdf864524788. XX FH Key Location/Qualifiers FH FT source 1..571 FT /organism="Neolaemosaccus cf. petulans MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2560" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738359" FT CDS <1..>571 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L6F1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L6F1" FT /protein_id="CUR50290.1" FT /translation="GTSLSMLIRTELGTPGSLMGNDQIYNSIVTAHAFIMIFFMVMPMM FT IGGFGNWLXPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMSSIINKGAGTGWTVYPPLS FT SNMTHEGASVDLAIFSLHMAGISSILXAMNFISTIINMSPSGMKMDQLTLFIWXVKITA FT ILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 571 BP; 198 A; 98 C; 75 G; 197 T; 3 other; ggaacctcat taagaatact tattcgaaca gaattaggaa cccctggcag tttaatagga 60 aatgatcaaa tttataactc tattgtaaca gcacatgctt ttattataat cttttttata 120 gttataccta taataattgg gggatttgga aactgattar tgcctttaat attaggagcc 180 cctgatatag ccttcccacg attaaataat ataagatttt gactactgcc cccttcatta 240 actctattaa ttataagtag aatcattaat aaaggagccg gaacaggatg aacagtatac 300 ccacctttat cgtcaaatat aacacatgaa ggagcatcag tagatttagc aatctttagt 360 ctccatatag cgggaatttc atctatctta rgagctataa actttatttc aactattatt 420 aatataagac catcaggaat aaaaatagat caattaactt tatttatctg arcagtaaaa 480 attactgcta ttcttttatt attatcttta cctgttttag caggagctat cactatactt 540 ttaactgacc gaaatattaa cacatccttt t 571 // ID LN889460; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889460; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Orthorhinus (Homorthorrhinus) sp. ARC2561 mitochondrial partial COI gene DE for cytochrome oxidase subunit 1, isolate ARC2561 XX KW . XX OS Orthorhinus (Homorthorrhinus) sp. ARC2561 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Orthorhinini; Orthorhinus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7d871ba4fcd4f0afd29d5eb355d04d80. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Orthorhinus (Homorthorrhinus) sp. ARC2561" FT /organelle="mitochondrion" FT /isolate="ARC2561" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738302" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ96" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ96" FT /protein_id="CUR50291.1" FT /translation="TVGTSMSMLIRAELGSPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSANVAHEGSSVDLAIFSLHMAGISSILGAMNFISTVLNMCPKGMKPEQMPLFVWSVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 185 A; 102 C; 90 G; 200 T; 0 other; acagtgggga cttccataag aatgttgatt cgagcagaat taggaagccc gggaagatta 60 attggaaatg accaaattta taattctatt gtaacagctc atgcttttat tataattttt 120 ttcatagtta tacctattat aatcggggga ttcggaaatt gacttgtacc attaatacta 180 ggggctcctg acatagcttt tccccgacta aataatataa gattttggct acttcctcca 240 agattaactt tacttttaat aagtagtatt gttgacaaag gtgccggaac aggatgaaca 300 gtttatccac ctctctcagc taatgtcgct catgaaggtt catcagtaga tttagctatt 360 tttagacttc acatagcagg aatctcttca atcttaggag caataaactt tatttctaca 420 gttcttaata tatgtccaaa aggaataaaa cccgaacaaa tacctctatt tgtatgatca 480 gtcaaaatta cagctatttt acttcttcta tcattaccag tattagccgg agcaattact 540 atattattaa ctgatcgtaa tattaataca tcttttt 577 // ID LN889461; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889461; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Niphades cf. costatus MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2563 XX KW . XX OS Niphades cf. costatus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Aminyopini; Niphades. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1f3265417dae343bd95eb21fe552de89. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Niphades cf. costatus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2563" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738360" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4M1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4M1" FT /protein_id="CUR50292.1" FT /translation="MVGTSLSMLIRTELGTPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSTNIAHEGSSVDLAIFSLHMAGISSILGAINFISTVINMRPAGMKPDQMSLFVWAVKI FT TAVLLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 181 A; 100 C; 83 G; 213 T; 0 other; atagtgggaa catctctaag aatacttatt cgtacagaat taggtacccc aggaagatta 60 attggaaatg atcaaattta taatacaatt gttactgctc atgcttttat tataattttt 120 tttatagtta tacctattat gattggagga ttcggaaatt gattagtccc tttaatatta 180 ggagctccag atatagcctt tcctcgtctt aataatataa gattttgatt actaccccca 240 tctctcactc ttctcttaat aagaagaatt attgataagg gagcaggtac aggttgaact 300 gtttaccctc ccctatctac taatattgcc catgaaggat catcagttga tctagctatt 360 tttagactac atatagcagg aatctcttct attttagggg ctattaattt tatttctaca 420 gttattaata tacgacctgc aggtataaaa ccagatcaaa tatccttatt tgtatgagct 480 gtaaaaatta cagcagtttt acttctatta tcattacctg tattagccgg tgcaattact 540 atacttttaa ctgaccgaaa tattaataca tcattct 577 // ID LN889462; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889462; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Heilipodus sp. ARC2566 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2566 XX KW . XX OS Heilipodus sp. ARC2566 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Heilipodus; unclassified Heilipodus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; e681d6e98f8e23b2cffdb7b9291877f4. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Heilipodus sp. ARC2566" FT /organelle="mitochondrion" FT /isolate="ARC2566" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736944" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZU4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZU4" FT /protein_id="CUR50293.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSVVGKGAGTGWTVYPP FT LSANIAHEGASVDLAIFSLHMAGVSSILGAINFISTVINMRPTGMNLDQMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNVNTSF" XX SQ Sequence 577 BP; 172 A; 117 C; 90 G; 198 T; 0 other; atagtaggta catctctaag aatattaatc cgaacagaac ttggtaatcc aggaagacta 60 attggagatg accaaattta taatactatt gttaccgccc acgcatttat tataattttc 120 tttatagtaa taccaattat aattggtgga tttggaaact gattagtccc tcttatatta 180 ggagcccctg atatggcatt ccctcgtctt aataatataa gattttgact tctgccccct 240 tctttaactc ttctcttaat aagaagagtt gtaggtaaag gtgcaggaac agggtgaact 300 gtataccccc ctttatcagc aaatattgcc cacgaaggag cctcagttga tttagcaatt 360 tttagactac acatagcagg tgtttcttca atcttaggag caattaattt catttccaca 420 gttattaata tacgccctac aggaataaac ctcgaccaaa tgccactttt tgtttgagca 480 gttaaaatta cagctatttt acttctcctt tcattacctg tcctagcagg ggcaattact 540 atacttctca ctgatcgtaa tgttaatacc tcttttt 577 // ID LN889463; SV 1; linear; genomic DNA; STD; INV; 559 BP. XX AC LN889463; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Phaenomerus peregrinator salomonicus mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2568 XX KW . XX OS Phaenomerus peregrinator salomonicus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Conoderinae; Phaenomerus. OG Mitochondrion XX RN [1] RP 1-559 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; bbef95e5d2b2130bb9a3795699fa7072. XX FH Key Location/Qualifiers FH FT source 1..559 FT /organism="Phaenomerus peregrinator salomonicus" FT /organelle="mitochondrion" FT /isolate="ARC2568" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738208" FT CDS <1..>559 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L445" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L445" FT /protein_id="CUR50294.1" FT /translation="SMLIRTELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMPIMIGGF FT GNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTFLLMSSIINNGAGTGWTVYPPLSNNIA FT HEGASVDLAIFSLHMAGVSSILGAMNFISTVINMRPKGMKLDRMSLFIWAVKITAILLL FT LSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 559 BP; 187 A; 85 C; 79 G; 208 T; 0 other; agtatattaa ttcgaactga attaggaaat cctggaagat taattggaaa tgatcaaatt 60 tataatacaa ttgtaactgc tcatgctttt attataattt tttttatagt tataccaatt 120 ataattgggg gatttggaaa ttgattagtc cccttaatgt taggagcacc tgatatagct 180 tttccacgat taaataatat aagattttga cttttacctc cttcattaac tttcctatta 240 ataagaagaa ttattaataa tggagcagga actggttgaa ctgtttatcc cccattatca 300 aataatattg cacatgaagg agcctcagtt gatttagcaa tttttagtct acatatggca 360 ggggtatctt caattcttgg agcaataaat tttatttcaa cagttattaa tatacgacca 420 aaaggaataa aattagatcg aatatcccta tttatttgag ctgttaaaat tacagctatt 480 ttactactct tatctctccc tgttctagca ggagccatca ctatactttt aacagatcga 540 aatattaata cttcatttt 559 // ID LN889464; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889464; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Hylobius piceus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2569 XX KW . XX OS Hylobius piceus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Hylobius. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0ca3d84aba05a0ccb6b2e83c8248e3b9. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Hylobius piceus" FT /organelle="mitochondrion" FT /isolate="ARC2569" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1002011" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZI1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZI1" FT /protein_id="CUR50295.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT VMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSNIIDKGAGTGWTVYPP FT LSANIAHEGASVDLAIFSLHMAGISSILGAINFISTAMNMRSSGMNPDQMSLFTWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 193 A; 97 C; 82 G; 205 T; 0 other; atagttggaa cttcacttag tatactaatt cgtacagagt taggaaatcc aggaagttta 60 attggaaatg atcaaattta taatacaatt gtaacagctc acgcttttat tataattttc 120 ttcatagtta taccagtaat aattggagga tttggtaatt gactagttcc attaatatta 180 ggagcccctg atatagcttt ccctcgattg aataatataa gattttgact cctacctcca 240 tctttaactc ttctgttaat aagaaatatt attgataaag gtgctggaac aggatgaaca 300 gtttatccac ctctatcagc taatatcgcc catgaaggtg catcagtaga tctcgcaatt 360 tttagattac atatagcagg aatttcttca attttaggag caattaattt tatctctact 420 gctataaata tacgatcatc tggaataaac ccagatcaaa tatctttatt tacttgagca 480 gtaaaaatta ctgcaatctt acttcttctt tctttaccag tactagcagg agctattact 540 atattattaa cagatcgaaa tattaacaca agatttt 577 // ID LN889465; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889465; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Liparus tenebrioides mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2570 XX KW . XX OS Liparus tenebrioides OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Molytini; Liparus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 83667334305fa0f8ecd6c45eb173051a. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Liparus tenebrioides" FT /organelle="mitochondrion" FT /isolate="ARC2570" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738205" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L2B6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L2B6" FT /protein_id="CUR50296.1" FT /translation="MVGTSLSMLIRTELSSPEKLIENDQIYNTIVTAHAFIMIFFMVMP FT VMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLGFLLLSSIINEGVGTGWTVYPP FT LSSNIAHEGMSVDLAIFSLHLAGMSSILGAINFISTVINMSSMGLKLBQKTLFIWXVKV FT TAILLLLSLPVLXGGISMLLTDRNLNTSF" XX SQ Sequence 577 BP; 186 A; 96 C; 84 G; 208 T; 3 other; atagtcggaa cctcactaag catactaatt cgtacagaat taagtagccc agaaaaatta 60 attgaaaatg atcaaattta taatacaatt gtgacagccc acgcttttat tataattttc 120 ttcatagtaa taccggtaat aattggggga tttggaaact gattaattcc tcttatatta 180 ggagctccag atatagcttt cccacgatta aacaatataa gattttgact attacctcct 240 tcattagggt ttcttttact aagaagaatc attaatgaag gggtaggaac tggttgaacg 300 gtatatcccc ccctatcttc aaacattgcc catgaaggta tatccgttga tttggctatt 360 tttagtctac atttagctgg aatatcctca atcttaggag caattaactt tatctctaca 420 gttattaata taagatctat aggtttaaaa ttaratcaaa aaactctttt tatctgarct 480 gttaaagtta cagctattct attactatta tctttacccg ttttarcggg ggggatttct 540 atattattaa ctgatcgaaa tttaaatact tcatttt 577 // ID LN889466; SV 1; linear; genomic DNA; STD; INV; 571 BP. XX AC LN889466; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Alcidodes sp. ARC2603 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2603 XX KW . XX OS Alcidodes sp. ARC2603 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Alcidinae; Alcidodes. OG Mitochondrion XX RN [1] RP 1-571 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 2e582f4d24eb5186c58bf39b4483f2f9. XX FH Key Location/Qualifiers FH FT source 1..571 FT /organism="Alcidodes sp. ARC2603" FT /organelle="mitochondrion" FT /isolate="ARC2603" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736953" FT CDS <1..>571 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1V4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1V4" FT /protein_id="CUR50297.1" FT /translation="MLGTSMSMIIRTELGSPGSLINDDQIYNSIVTAHAFVMIFFMVMP FT IMIGGFGNWLVPLMLSAPDMAFPRLNNMSFWLLPPSLLFLLMSMMTDKGVGTGWTVYPP FT LSSNLGHSGPAVDMAIFSLHMAGVSSILGAINFISTMANMRPMKLEQMTLFTWAVKITA FT ILLLFSLPVLAGAITMLLTDRNVNTSF" XX SQ Sequence 571 BP; 188 A; 122 C; 78 G; 183 T; 0 other; atattaggaa cttccataag aataattatt cgaacagaat taggaagccc tggcagatta 60 atcaatgacg atcaaattta caactccatt gttactgccc atgcattcgt tataattttc 120 ttcatagtta taccaatcat aatcggagga ttcggtaact gattagtccc actaatatta 180 agagcacctg atatagcttt cccccgtctt aataatataa gattttgact attacccccc 240 tccttactat ttcttcttat aagaataata acagacaaag gagttggtac aggttgaact 300 gtctaccccc cactatcctc taatctagga catagaggac ctgcagtaga tatagctatt 360 tttagccttc acatagcagg agtgtcctca atccttgggg caattaattt tatttcaaca 420 atagctaata tacgcccaat aaaacttgaa caaataaccc tatttacatg agcagtaaaa 480 attactgcaa ttttattact attctcctta ccagttcttg ctggagcaat cacaatactc 540 ttaacagatc gtaatgtaaa tacctcattt t 571 // ID LN889467; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889467; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchini gen. sp. ARC2604 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2604 XX KW . XX OS Cryptorhynchini gen. sp. ARC2604 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; unclassified Cryptorhynchinae. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; cf5d3681595da7ed12770bcea330d238. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchini gen. sp. ARC2604" FT /organelle="mitochondrion" FT /isolate="ARC2604" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1742678" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Z1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Z1" FT /protein_id="CUR50298.1" FT /translation="MMGTSLSVLIRTELGTPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMSSIMDKGAGTGWTVYPP FT LSTNIAHEGASVDLAIFSLHMAGVSSILGAMNFISTIINMRPTGMKLDQMTLFTWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 186 A; 108 C; 81 G; 201 T; 1 other; ataataggaa cctctttaag agttcttatt cgaacagaat taggaacacc aggtagatta 60 attggaaatg atcaaattta caataccatt gttactgcac atgcttttat tataattttt 120 tttatagtta tacccattat aattggagga tttggaaatt gattagtgcc actaatacta 180 ggagctcctg acatagcttt ccctcgtctt aataatataa gtttctgact tctgcccccc 240 tctcttactc ttcttattat aagaagaatt atagataaag gcgctgggac aggatgaacg 300 gtttatcccc ccttatccac taacatcgct catgaaggag cttctgtaga tttagctatt 360 tttagactac atatagcagg agtttcatct attcttggag caataaattt tatttctaca 420 attattaaca tacgcccaac aggaataaaa ttagatcaaa taaccttatt cacatgagcc 480 gtaaaaatta cagctatcct tcttctctta tctcttccag tattagcagg agcaattacm 540 atattattaa ctgatcgaaa tattaataca tcatttt 577 // ID LN889468; SV 1; linear; genomic DNA; STD; INV; 562 BP. XX AC LN889468; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Acallophilus sp. ARC2607 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2607 XX KW . XX OS Acallophilus sp. ARC2607 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Acallophilus; unclassified Acallophilus. OG Mitochondrion XX RN [1] RP 1-562 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3820074598e25b80ef07f9964c59f7d3. XX FH Key Location/Qualifiers FH FT source 1..562 FT /organism="Acallophilus sp. ARC2607" FT /organelle="mitochondrion" FT /isolate="ARC2607" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736917" FT CDS <1..>562 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4D6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4D6" FT /protein_id="CUR50299.1" FT /translation="MSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMPIMIGG FT FGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLISSSIMDKGAGTGWTVYPPLSSNI FT THEGMSVDLAIFSLHMAGIASILGAMNFISTIINMRTKGMKLERMPLFVWAVKITAILL FT LLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 562 BP; 183 A; 102 C; 75 G; 202 T; 0 other; ataagaatat taatccgtac tgaattagga aacccaggca ccttaattgg aaatgaccaa 60 atttataatt ctattgtaac tgcccatgcc tttattataa ttttctttat agttatacca 120 attataattg gaggctttgg taattgatta gttcctctta tactaggagc ccctgatata 180 gctttccctc gacttaataa tataagattt tgactcttac ctccttcctt aactcttcta 240 attagaagaa gaattataga caaaggagct ggaacaggat gaactgttta cccaccacta 300 tcttctaata ttacccatga aggaatatct gtagatctag caatttttag tcttcatata 360 gctggtattg cttctattct tggtgctata aattttattt caactattat taatatacgt 420 acaaaaggaa taaaacttga acgaatacct ttatttgtat gagcagtaaa aattactgca 480 atcctccttt tactttcatt accagtactt gcaggagcaa tcacaatact tttgaccgat 540 cgaaatatta atacatcatt tt 562 // ID LN889469; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889469; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pimelocerus sp. (Dyscerus) ARC2609 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2609 XX KW . XX OS Pimelocerus sp. (Dyscerus) ARC2609 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Pimelocerus; unclassified Pimelocerus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1f37bd7fb17f7b43a1f8142657f93d84. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Pimelocerus sp. (Dyscerus) ARC2609" FT /organelle="mitochondrion" FT /isolate="ARC2609" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1742673" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZ94" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZ94" FT /protein_id="CUR50300.1" FT /translation="MIGTSLSMLIRTELGNPGSLISDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSTNIAHEGXSVDLAIFXLHMAGISSILGAINFISTSINMRSSGMKPDQMTLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 195 A; 97 C; 74 G; 209 T; 2 other; ataattggta catccctaag aatactaatt cgaactgaat taggtaatcc tggaagacta 60 attagtgacg accaaattta taatactatt gtaactgcac atgcttttat tataatcttt 120 tttatagtaa taccaattat aattggagga tttggtaact gactaattcc attaatatta 180 ggagcccctg atatagcctt cccacgatta aataatataa gattctggtt attacctcca 240 tcattaactt tattacttat aagaagaatt attgataaag gagctggaac aggctgaaca 300 gtatacccac ctttatcaac taatattgct catgaaggar catcagtaga tttagcaatt 360 tttaractac atatagctgg aatttcttct attctaggag ctattaattt tatttcaact 420 tcaattaata tacgttcatc agggataaaa cctgatcaaa taacactttt tatttgagca 480 gtaaaaatta ctgctatttt actcctttta tctttaccag ttctagcagg tgctatcact 540 atattattaa ctgatcgaaa tattaatacc tcctttt 577 // ID LN889470; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889470; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paramecops (sensu lato) sp. ARC2615 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2615 XX KW . XX OS Paramecops (sensu lato) sp. ARC2615 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Hylobiini; Paramecops. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 639a067796ecfa1c0e9a8cf01ec742b3. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Paramecops (sensu lato) sp. ARC2615" FT /organelle="mitochondrion" FT /isolate="ARC2615" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738372" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Y9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Y9" FT /protein_id="CUR50301.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSANIAHEGASVDLAIFSLHMAGISSILGAINFISTAINMRSSGMKSDQMSLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 184 A; 99 C; 87 G; 202 T; 5 other; atagttggra catcycttag aatactaatt cgaactgaat taggaaaccc gggcaggtta 60 atcggggacg atcaaatyta taataccatt gtaactgccc atgctttcat tataattttt 120 tttatagtaa tacctattat aattggaggt tttgggaact gactagtccc tctaatactt 180 ggagctccag atatggcatt cccacgattg aataatataa gattctgact tctgcctcct 240 tcattaacct tacttttaat aagaagaatt attgacaaag gagccggaac aggctgaacy 300 gtataccctc ccttatctgc aaatattgct catgaaggag cytcagttga tctagcaatt 360 tttagactac atatagcagg gatttcctct attttaggag ctattaattt tatttctaca 420 gcaattaata tacgatcttc aggaataaaa tcagatcaaa tatctttatt tatttgagct 480 gtaaaaatta ctgcaatttt attattatta tctttaccag ttttagctgg cgcaattact 540 atattattaa cagatcgaaa tattaataca tcatttt 577 // ID LN889471; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889471; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Seleuca cf. setosula MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2616 XX KW . XX OS Seleuca cf. setosula MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Lithinini; Seleuca. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d518a2548a56c6135fe7836d40e38c42. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Seleuca cf. setosula MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2616" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1743268" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L237" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L237" FT /protein_id="CUR50302.1" FT /translation="MVGTSLSMLIRTELGIPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGISSILGAMNFISTIINMRPAGMKLERMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 186 A; 106 C; 82 G; 203 T; 0 other; atagttggta catctttaag aatactaatt cgtaccgaat taggtattcc tggaagatta 60 attggagatg accaaattta taatacaatt gtaacagccc atgcttttat cataattttc 120 tttatggtaa tgccaattat aattggtgga tttggaaact gattaattcc tctaatacta 180 ggagctcctg atatagcttt cccacgatta aataatataa gattttgact tctcccacca 240 tccttaactc ttcttttaat aagaagaatc attgataaag gagcagggac aggatgaaca 300 gtttatccac ctttatcatc aaatattgcc catgaaggaa tctctgttga cttagctatt 360 ttcagtcttc atatagcagg aatctcatcc attcttggag ccataaattt tatttctaca 420 attattaata tacgtcctgc aggaataaaa cttgaacgaa taccactttt tgtatgagct 480 gttaaaatta cagctattct attattatta tcccttccag ttcttgcagg agcaattact 540 atactactga cagatcgaaa cattaacaca tcctttt 577 // ID LN889472; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889472; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Praodes sp. ARC2619 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2619 XX KW . XX OS Praodes sp. ARC2619 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Praodes; unclassified Praodes. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 121a78048dc1379188d8d9f7405a45cc. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Praodes sp. ARC2619" FT /organelle="mitochondrion" FT /isolate="ARC2619" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1737002" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0J4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0J4" FT /protein_id="CUR50303.1" FT /translation="MVGTSLXVLIRTELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLXAPDMAFPRLNNMXFWLLPPSLTFLLASSIIDKGAGTGWTVYPP FT LSANISHEGPSVDLXIFXLHMAGVSSILGAINFISTIFNMHPKGMKPERLSLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 172 A; 119 C; 85 G; 194 T; 7 other; atagtrggta cctctctaar agttcttatc cgcactgaat taggtacccc tggaagatta 60 attggagatg atcaaattta caataccatt gttacagctc atgcctttat tataattttt 120 tttatagtta tacctatcat aattggggga tttggaaact gacttgttcc cttgatatta 180 rgagctccgg atatagcctt cccacgtctt aataatataa rattctggct tcttccccca 240 tctttaacct tccttcttgc aagcagaatt attgataaag gggcaggaac agggtgaacg 300 gtatacccac ctctatcagc aaatatttct catgaaggcc catcagttga tttarcaatc 360 tttaractac acatagcagg agtttcctct attttagggg caattaattt tatctcaaca 420 attttcaata tacatccmaa aggaataaaa ccagaacgtc tatcactttt tgtatgggcc 480 gtaaaaatta cagctattct attactatta tccctccctg ttttagcagg agcaattacg 540 atactattaa cagatcgaaa cattaatacc tctttct 577 // ID LN889473; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889473; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Setarhynchus sp. ARC2626 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2626 XX KW . XX OS Setarhynchus sp. ARC2626 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Setarhynchus; unclassified Setarhynchus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a2b169eb679ae0188cb5fbd6148182b4. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Setarhynchus sp. ARC2626" FT /organelle="mitochondrion" FT /isolate="ARC2626" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1742701" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Z6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Z6" FT /protein_id="CUR50304.1" FT /translation="MIGTSLSMLIRTELGTPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSISLLLMSSIIDNGVGTGWTVYPP FT LSMNTAHNGSAVDLAIFSLHMAGISSILGAMNFISTISNMRPTGMNMDQMPLFAWAVNI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 176 A; 106 C; 79 G; 216 T; 0 other; ataattggta cttctctcag aatactaatt cgcacagaac ttggaacccc aggaagttta 60 attggtaatg atcaaattta taattctatt gttacagctc acgcttttat tataattttt 120 tttatagtta taccaattat aatcggagga tttggaaatt gacttgtacc tctaatactt 180 ggggcacctg atatggcttt ccctcgatta aataatataa gtttttgact tctcccccct 240 tcaattagat tattattaat aagcagaatt attgacaatg gagttggaac tggttggaca 300 gtttacccac ctctatcaat aaatacagct cataatggct ctgctgtaga tttagctatc 360 tttagcctcc atatagctgg aatttcttct atcctaggag ctataaattt tatttctact 420 atttcaaata tacgaccaac tggtataaat atagatcaaa tacctctttt tgcatgagct 480 gtaaatatca cagctattct tcttttacta tctctacctg ttttagcagg agctattact 540 atattattaa ctgaccgaaa tatcaataca tcatttt 577 // ID LN889474; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889474; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Semnorhynchus cayennensis mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2627 XX KW . XX OS Semnorhynchus cayennensis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Semnorhynchus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 53a2fee436ba9c05b720dae31ca8e024. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Semnorhynchus cayennensis" FT /organelle="mitochondrion" FT /isolate="ARC2627" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738209" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZH1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZH1" FT /protein_id="CUR50305.1" FT /translation="MVGTSLSMLIRTELGNPGSFIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LASNVAHEGISVDLAIFSLHMAGISSILGAINFISTIINMRPKGMKLEQMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 191 A; 94 C; 79 G; 213 T; 0 other; atagttggaa cttcactcag tatactaatt cgtacagaac ttggaaaccc tggaagtttt 60 attggaaatg atcaaattta caactctatc gtaaccgcac atgcttttat tataattttt 120 tttatagtaa tacctattat aatcggagga tttggaaatt gattaattcc tctaatatta 180 ggagctcctg atatagcttt cccacgactt aataatataa gattctgatt acttcctcct 240 tcattaaccc tattactaat aagaagtatt attgataaag gagcaggaac aggatgaact 300 gtttatcctc ctttggccag aaatgtagct catgaaggaa tctcagtaga tttagcaatc 360 tttagactac atatagcagg aatttcatct attcttggtg ctattaattt tatttcaact 420 attattaata tacgtcctaa aggaataaaa ttagaacaaa tacctttatt tgtatgagca 480 gtaaaaatta ctgctatttt attattatta tctctacctg ttcttgcagg agctattaca 540 atattactaa ctgatcgaaa tattaatact tcctttt 577 // ID LN889475; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889475; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptorhynchus sp. ARC2629 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC2629 XX KW . XX OS Cryptorhynchus sp. ARC2629 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Cryptorhynchus; unclassified Cryptorhynchus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 020fc6e44b2a112e578b280b53d8d077. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptorhynchus sp. ARC2629" FT /organelle="mitochondrion" FT /isolate="ARC2629" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736923" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L6G9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L6G9" FT /protein_id="CUR50306.1" FT /translation="MLGTSLSMLIRTELGTPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMSSIIDKGAGTGWTVYPP FT LSGNIAHEGISVDLAIFSLHMAGISSILGAMNFISTVINMHPMGMTPERLSLFVWAVQI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 172 A; 131 C; 84 G; 190 T; 0 other; atactaggta catctttaag aatactcatt cgaaccgaat taggaacccc tggaacttta 60 atcggcaatg atcaaatcta caatagtatc gtaactgctc atgcttttat tataattttt 120 tttatagtta tacctattat aatcggagga ttcggaaact gattagtccc cctaatactc 180 ggagcacctg atatagcctt tccccgactt aacaatataa gattctgatt actgccccct 240 tcattaaccc tactaattat aagtagaatt atcgacaaag gtgccggcac tgggtggaca 300 gtttatcccc ccctatctgg aaatatcgca cacgaaggaa tttctgttga tttagccatc 360 tttagcctcc atatagccgg aatttcttca attctaggag caataaattt tatttcaact 420 gtaatcaaca tacatcctat agggataacc ccagaacgac tatctctatt cgtgtgggct 480 gttcaaatta cagcaattct tcttcttctt tccctacctg ttcttgctgg agcaattact 540 atactattaa cagatcgaaa tatcaataca tctttct 577 // ID LN889476; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889476; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pappista aspis mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2630 XX KW . XX OS Pappista aspis OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Pappista. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 1ca4166cf087f5fb395ff2a021470835. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Pappista aspis" FT /organelle="mitochondrion" FT /isolate="ARC2630" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738271" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZA9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZA9" FT /protein_id="CUR50307.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIMDKGAGTGWTVYPP FT LSTNIAHEGASVDLAIFSLHMAGISSIMGAMNFISTVINMRPMGMNPDQMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 186 A; 102 C; 79 G; 210 T; 0 other; atagtaggaa cctctctaag aatattaatt cgtacagaat taggaaatcc tggaagatta 60 attggtaatg atcaaattta caattcaatt gtaaccgctc atgcctttat tataattttc 120 tttatagtta taccaattat aattggtgga tttggaaatt gattagtacc tctaatacta 180 ggtgccccag atatagcttt tcctcgtctt aataatataa gattctgact tctacccccc 240 tctcttacac tcttacttat aagaagtatt atagataagg gagcagggac aggatgaaca 300 gtttatcccc ctctttcaac taatattgct catgaaggag cctctgtaga tttagcaatc 360 tttagattac atatagctgg aatttcatct attataggtg caataaactt tatttctact 420 gtaattaata tacgacccat aggaataaat cctgatcaaa tacctctatt tatttgagca 480 gttaaaatta ccgcaattct tcttttatta tctcttccag ttcttgcagg agcaattact 540 atattattaa cagatcgaaa tattaataca tcttttt 577 // ID LN889477; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889477; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eubulus sp. ARC2631 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2631 XX KW . XX OS Eubulus sp. ARC2631 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Eubulus; unclassified Eubulus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 8477576bac5ef4e817ee368898cab4ae. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Eubulus sp. ARC2631" FT /organelle="mitochondrion" FT /isolate="ARC2631" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736925" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4N8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4N8" FT /protein_id="CUR50308.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLMSSIMNKGAGTGWTVYPP FT LSTNISHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRSTGMNPDQMPLFVWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 184 A; 112 C; 80 G; 201 T; 0 other; atagtaggaa cttcactaag aatactaatt cgaactgaat taggaaaccc tggaagatta 60 attggtaatg accaaattta taactctatt gttacagctc acgcttttat tataattttc 120 tttatagtaa tacctattat aattggggga ttcggaaact gacttgtacc tttaatatta 180 ggtgcccctg atatagcatt ccctcgactt aataatataa gattttgact tcttccacca 240 tctcttagtc tattattaat aagaagtatt ataaataaag gagcaggaac aggatgaact 300 gtttacccac ctctttctac taacatctcc catgaaggag cctcagtaga tctggcaatt 360 tttagtctac atatagcagg aatttcatct attctaggag caataaactt tatttctaca 420 gttattaata tacgatccac tggaataaac ccagaccaaa tacctctatt tgtctgagct 480 gttaaaatta ctgctattct actcttatta tctttgccag ttcttgctgg agctatcact 540 atattactta cagatcgaaa cattaacacc tctttct 577 // ID LN889478; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889478; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Chalcodermus cf. calidus MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC2632 XX KW . XX OS Chalcodermus cf. calidus MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Sternechini; Chalcodermus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; c57d101a7b9f10a53d6f380552e7e1ec. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Chalcodermus cf. calidus MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC2632" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738344" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZW1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZW1" FT /protein_id="CUR50309.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLLSSMTNNGAGTGWTVYPP FT LSANMTHEGSSVDLAIFSLHMAGISSILGAINFISTIINMHPKGMKMDKLPLFIWAVKI FT TAILLLFSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 191 A; 107 C; 74 G; 205 T; 0 other; atagtaggta cttcattaag aatattaatt cgtacagaat taggaaatcc tggaagatta 60 attggtaatg atcaaattta taatactatt gttacagctc atgcatttat tataattttc 120 ttcatagtaa taccaattat aattggagga tttggaaatt ggttagtccc tttaatactt 180 ggtgctcctg atatagcttt cccacgccta aataatataa gattctgatt actaccacca 240 tccctctctc ttcttctttt aagaagaata accaataatg gtgcaggaac aggatgaact 300 gtctatcccc ccctatctgc taatataacc catgaaggat catcagttga tttagccatt 360 tttagtctcc atatagctgg aatctcatca attcttggag ctattaactt catttcaaca 420 attattaata tacaccctaa aggaataaaa atagataaac tccccctatt tatttgagct 480 gtaaaaatta cagcaatttt attattattt tctctacccg tacttgctgg agcaattact 540 atattattaa cagaccgaaa tatcaataca tcttttt 577 // ID LN889479; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889479; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lyterius sp. ARC2922 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2922 XX KW . XX OS Lyterius sp. ARC2922 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Baridinae; Lyterius; unclassified Lyterius. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d2916e9346c2ceac2fcb084efcc9df89. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Lyterius sp. ARC2922" FT /organelle="mitochondrion" FT /isolate="ARC2922" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736980" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L463" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L463" FT /protein_id="CUR50310.1" FT /translation="MVGTXLSMLIRTELGNPGSXIGDDQIYXTIVXAHAFIMIFFMVMP FT IMIGGFGNWLXPLMLGAPDMAXPRLNNMXXWLLPPSLVLLLMSXIVDKGAGTGWTVYPP FT LSSNIAHEGASVDLAIFSLHMAGISSLLGAMNFISTVMNMRPEGMKPDRMSLFVWAVQI FT TAVLLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 181 A; 114 C; 85 G; 186 T; 11 other; atagttggaa cawckttaag tatattaatt cgaactgaat taggaaatcc aggaagakta 60 attggagatg accaaattta tmataccatt gtawcagccc acgcctttat tataattttt 120 tttatagtta tacccattat aattgggggg ttcggaaatt gattartacc cttaatacta 180 ggagcmccag atatggccwt ccctcgatta aataatataa raktctgact tcttccccca 240 tcattagtcc tcttattaat aagaaraatt gttgacaagg gtgctggaac aggatgaaca 300 gtttacccac ccttatcatc taatattgca catgaaggag cctctgttga cttagccatt 360 tttagactac atatagcagg aatctcctcc ttacttggag caataaattt tatttctaca 420 gttataaaca tacgacctga aggaataaaa cctgaccgaa tatctctatt tgtctgagcc 480 gtccaaatta ctgcagttct attacttctc tcactaccag ttctagcagg agcaattact 540 atacttttaa cagaccgtaa tattaatact tcattct 577 // ID LN889480; SV 1; linear; genomic DNA; STD; INV; 562 BP. XX AC LN889480; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Panopides anticus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2929 XX KW . XX OS Panopides anticus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Panopides. OG Mitochondrion XX RN [1] RP 1-562 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 3dffaaa04903d5949d7408d579125204. XX FH Key Location/Qualifiers FH FT source 1..562 FT /organism="Panopides anticus" FT /organelle="mitochondrion" FT /isolate="ARC2929" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738265" FT CDS <1..>562 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZJ6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZJ6" FT /protein_id="CUR50311.1" FT /translation="LSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMPIMIGG FT FGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPPLSSNV FT AHEGISVDLAIFSLHMAGVSSILGAMNFISTIVNMRPKGMKLDRMPLFIWAVKITAILL FT LLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 562 BP; 179 A; 98 C; 76 G; 206 T; 3 other; cttagaatat taattcgtac tgaattaggt aatcccggaa cattaattgg taatgatcaa 60 atctataact ctattgttac agcccatgct tttattataa ttttttttat agttatacca 120 attataatcg gaggatttgg taattgatta attcctctta tattaggagc ccctgatata 180 gccttcccac ggcttaacaa tataagattt tgacttcttc ccccatcttt aactttatta 240 ctaataagaa gaattattga taaaggagca ggaacaggtt gaactgttta tccaccatta 300 agatctaatg tagcccacga rggaatttct gtagacttag ctatttttag attacatata 360 gcaggagttt cttctattct yggagcaata aactttattt ctacaattgt taatatacga 420 cccaaaggta taaaattaga ccgcataccc ctatttattt gagcagtaaa aattactgca 480 atcctactyt tactatcttt accagttctt gctggagcta ttactatact tttaacagat 540 cgaaatatta atacttcatt tt 562 // ID LN889481; SV 1; linear; genomic DNA; STD; INV; 451 BP. XX AC LN889481; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Odosyllis congesta mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC2930 XX KW . XX OS Odosyllis congesta OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Gasterocercini; Odosyllis. OG Mitochondrion XX RN [1] RP 1-451 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 912215bf2a4bf2988e45ca073d6ddf00. XX FH Key Location/Qualifiers FH FT source 1..451 FT /organism="Odosyllis congesta" FT /organelle="mitochondrion" FT /isolate="ARC2930" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738261" FT CDS <1..>451 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L2D0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L2D0" FT /protein_id="CUR50312.1" FT /translation="VMPIMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLSLLLM FT SSIIDKGAGTGWTVYPPLSANIAHEGVSVDLAIFSLHMAGISSILGAINFIFTMINMRP FT SGMDLDRLPLFSWAVKITAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 451 BP; 125 A; 91 C; 77 G; 158 T; 0 other; gttataccaa ttataattgg gggatttgga aattgattaa ttccactaat actcggggcc 60 ccggatatgg ccttccctcg tttaaataat ataagatttt gactcctccc cccctcacta 120 tccttattat taataagcag aattatcgat aagggggcgg gaacaggttg gactgtttac 180 ccacccttat cagctaatat tgcccatgag ggagtatctg ttgatctagc aattttcaga 240 ttacacatag ctggaatttc atctatctta ggagctatta attttatctt tactataatt 300 aatatgcgac ctaggggtat agatctggat cgccttcctt tattttcatg agctgtaaaa 360 attacagcaa ttcttttatt actatctttg cctgtcttag cgggggctat caccatacta 420 ctaactgatc gaaatattaa cacttcattt t 451 // ID LN889482; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889482; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ampagia sp. ARC3408 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3408 XX KW . XX OS Ampagia sp. ARC3408 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ampagia; unclassified Ampagia. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; fcf091adf26c7ceded0c604cd1c9c166. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ampagia sp. ARC3408" FT /organelle="mitochondrion" FT /isolate="ARC3408" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736956" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1X0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1X0" FT /protein_id="CUR50313.1" FT /translation="MVGTSLSMLIRTELGNPGNLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLILLLSSSIINKGSGTGWTVYPP FT LSSNIAHQGISVDLTIFSLHMAGISSILGAINFISTIGNMRTKGMKSDQMPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 191 A; 111 C; 72 G; 203 T; 0 other; atagttggaa cctcattaag aatactcatt cgaactgaat taggaaaccc aggaaactta 60 attggaaatg atcaaattta caattcaatc gttacagccc acgcttttat tataattttt 120 tttatagtca tacctattat aattggagga tttggtaatt gacttatccc ccttatatta 180 ggagccccag atatagcttt ccctcgactt aataatataa gattttgact cctccctcct 240 tcactaattc ttctattaag aagaagaatt attaacaaag gatcaggaac tggatgaaca 300 gtctatcccc ctctttcttc taatattgct caccaaggta tttcagtaga tttaactatc 360 tttagtttac atatagccgg aatttcatct attcttggag caattaattt tatctcaaca 420 attggaaata tacgaacaaa aggaataaaa tctgatcaaa tacctttatt tatttgagca 480 gtaaaaatta cagctattct cctcctacta tctttaccag ttcttgcagg cgcaattact 540 atattattaa cagatcgaaa tatcaatacc tcttttt 577 // ID LN889483; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889483; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ectatorrhinus alatus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3414 XX KW . XX OS Ectatorrhinus alatus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Ithyporini; Ectatorrhinus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 0fb9312fbbca4c8d8be619202dc5b6a4. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ectatorrhinus alatus" FT /organelle="mitochondrion" FT /isolate="ARC3414" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738249" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L206" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L206" FT /protein_id="CUR50314.1" FT /translation="MVGTSLSMLIRTELGSPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLMLLLMSSIIDKGAGTGWTVYPP FT LSSNISHEGASVDLAIFSLHMAGVSSILGAMNFISTIINMRPEGMNYDRITLFTWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 188 A; 88 C; 81 G; 220 T; 0 other; atagtcggaa cttctctaag tatactaatt cgtactgaat taggaagacc aggaagatta 60 attggtgatg atcaaattta taatacaatt gtaactgcac atgcttttat tataattttc 120 tttatagtaa taccaattat aattggaggt tttggaaatt gattagttcc attaatatta 180 ggagctcctg atatagcatt tcctcgatta aacaatataa gattttgact tttaccccca 240 agattaatat tactattaat aagaagtatt attgataaag gagcaggaac aggttgaact 300 gtttatcccc ctttatcttc taatatctct catgaaggag cttctgtaga tttagctatt 360 tttagtcttc atatagcagg tgtatcatca attctaggag caataaattt tatttctacc 420 attattaata tacgacctga aggaataaat tatgaccgta tcactctttt tacttgagct 480 gtaaaaatta cagcaatttt actacttctt tctctacctg ttttagcagg tgcaattact 540 atacttttaa ctgatcgtaa tattaataca tcatttt 577 // ID LN889484; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889484; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pinacopus sp. ARC3472 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3472 XX KW . XX OS Pinacopus sp. ARC3472 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Molytini; Pinacopus; unclassified Pinacopus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 45dd37c7a3ad217bed43e7d46f700a94. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Pinacopus sp. ARC3472" FT /organelle="mitochondrion" FT /isolate="ARC3472" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736996" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4F1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4F1" FT /protein_id="CUR50315.1" FT /translation="MVGTSLSMLIRIELGNPGSFIGNDQIYNSMVTAHAFMMIFFMVMP FT IMIGGFGNWLVPLMLAAPDMAFPRMNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHLAGISSILGAINFISTVINMRPTGMKLDQMSLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 188 A; 86 C; 79 G; 224 T; 0 other; atagtaggaa cttctttaag aatattaatt cgaattgaat taggaaatcc tggaagattt 60 attggaaatg accaaattta taattctata gtaactgctc atgcttttat aataattttt 120 tttatagtta tgccaattat aattggtgga tttggaaatt ggttagttcc actaatactt 180 gcagctccag acatagcatt ccctcgaata aataatataa gattttgatt actacctcct 240 tcattaaccc tacttcttat aagaagaatt attgataaag gagcaggaac gggttgaaca 300 gtttatcctc ctttatcttc aaatattgca catgaaggaa tttcagtaga tcttgcaatt 360 tttagattac atcttgctgg aatttcttct attttaggag ctattaattt tattagtact 420 gtaattaata tacgacctac cggaataaaa ctagatcaaa tatctttatt tatttgagct 480 gttaaaatta cagctattct tttactttta tctttacctg tattagcagg agcaattact 540 atactcttaa ctgaccgtaa tattaataca tcttttt 577 // ID LN889485; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889485; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropteroides sp. ARC3485 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3485 XX KW . XX OS Poropteroides sp. ARC3485 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropteroides; unclassified Poropteroides. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a97da955467858874ffe70cfd64d1aab. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Poropteroides sp. ARC3485" FT /organelle="mitochondrion" FT /isolate="ARC3485" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736998" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZB0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZB0" FT /protein_id="CUR50316.1" FT /translation="MIGTSLSMLIRTELSNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGXGTGWTVYPP FT LSXNIAHEGASVDLAIFSLHMAGISSILGAMNFISTIINMRPTGMKFDRIPLFVWSVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 178 A; 98 C; 76 G; 213 T; 12 other; ataattggta cttctttaag aatactaatt cgaactgaac taagaaatcc aggaactctt 60 attggcaatg atcaaattta taattctatt gtaacagctc atgcttttat tatrattttt 120 ttcatagtta tgcccattat aattggaggy tttggtaatt gattagttcc ccttatactt 180 ggagccccag ayatagcctt tccacgatta aataatataa gattttgact tttaccccct 240 tctttaaccc tacttctaat aagaagtatt attgataaag gagyaggrac tggytgaaca 300 gtttacccyc cattatcygm taatattgct caygaaggag catctgttga tttagcaatt 360 tttagwctcc atatagcagg aatttcatca attcttggrg ctataaattt tatttcaaca 420 attattaata tacgaccaac tggaataaaa ttcgatcgta tccccttatt tgtttgatca 480 gtaaaaatta cagctattct tttattatta tccttaccag tattagctgg tgcaattaca 540 atacttttaa ctgatcgaaa tatcaatacc tcttttt 577 // ID LN889486; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889486; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Poropterus waterhousei mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3486 XX KW . XX OS Poropterus waterhousei OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Poropterus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 27e54e29e60addc6c14ec453d9e4be29. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Poropterus waterhousei" FT /organelle="mitochondrion" FT /isolate="ARC3486" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738278" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L204" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L204" FT /protein_id="CUR50317.1" FT /translation="MVGTSLSMLIRTELSNPGTLIGNDQTYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVNKGAGTGWTVYPP FT LSSNIAHEGISVDLAIFSLHMAGISSILGAMNFISTMFNMRPTGMKPDQMPLFVWAVKI FT TATLLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 193 A; 101 C; 74 G; 209 T; 0 other; atagtaggta catctttaag aatactaatt cgtactgaat taagaaatcc aggaacacta 60 attggcaatg atcaaactta taattcaatc gtcacagctc atgcctttat tataattttt 120 tttatagtaa taccaattat aattggtgga tttggaaatt gattaattcc actaatatta 180 ggagctcctg atatagcgtt tcctcgatta aataatataa gattctgact acttcccccc 240 tctttaaccc ttctcttaat aagaagaatc gttaataaag gagctggcac aggttgaaca 300 gtttatccac ctttatcatc taatattgcc catgaaggaa tttctgtaga cttagctatt 360 tttagtctac atatagcagg aatttcctct attttaggag ctataaattt tatttcaaca 420 atatttaata tacgtccaac aggaataaaa ccagatcaaa tacccctatt tgtttgagct 480 gtaaaaatta ccgcaactct tttattatta tcattaccag ttttagctgg agctattaca 540 atacttttaa cagatcgtaa tattaatact tcatttt 577 // ID LN889487; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889487; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Paleticus subereus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3487 XX KW . XX OS Paleticus subereus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Paleticus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5e23aba54173581c364e97ea290fa8c7. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Paleticus subereus" FT /organelle="mitochondrion" FT /isolate="ARC3487" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738263" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L252" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L252" FT /protein_id="CUR50318.1" FT /translation="MVGTSLSMLIRTELGNPGTLIGNDQIYNSIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSSNVAHEGASVDLAIFSLHMAGVSSILGAMNFISTVINMRPAGMNPDRVPLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 164 A; 118 C; 93 G; 202 T; 0 other; atagtgggaa cttccctcag aatactaatt cgaactgagc taggaaaccc agggactcta 60 attggaaatg atcaaattta taactccatt gtaacagccc atgcttttat catgattttc 120 ttcatggtca taccaatcat aattgggggc tttggaaatt gattagttcc tcttatacta 180 ggagcccctg atatagcctt tcctcgtctt aataatataa gattttgact gttaccccct 240 tctttaaccc ttttactaat aagaagaatt gttgataaag gagcaggaac aggttgaact 300 gtttaccccc cactttcttc aaatgtagct catgaaggag cctcagttga tcttgccatt 360 tttagacttc atatagctgg tgtctcttct attcttgggg ctataaactt tatctctacg 420 gttattaata tacgaccagc aggtataaat cctgatcgag tacccttatt catttgagca 480 gttaaaatta cagcaatttt actacttctt tctctgcctg tactagcagg tgctattact 540 atattattga ctgatcgaaa cattaataca tcatttt 577 // ID LN889488; SV 1; linear; genomic DNA; STD; INV; 568 BP. XX AC LN889488; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ephrycus sp. ARC3491 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3491 XX KW . XX OS Ephrycus sp. ARC3491 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Ephrycus; unclassified Ephrycus. OG Mitochondrion XX RN [1] RP 1-568 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 33698bd540b2778814b7e74fef2e60b3. XX FH Key Location/Qualifiers FH FT source 1..568 FT /organism="Ephrycus sp. ARC3491" FT /organelle="mitochondrion" FT /isolate="ARC3491" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736966" FT CDS <1..>568 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L0K7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L0K7" FT /protein_id="CUR50319.1" FT /translation="ASLSMXIRTELGSPGTLIGNDQIYNSIVTAHAFIMIFFMVMPVMI FT GGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPPLSS FT NIAHEGASVDLAIFSLHMAGISSILGAMNFISTVINMRPMGLNSDRMPLFIWAVKITAI FT LLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 568 BP; 168 A; 104 C; 80 G; 215 T; 1 other; gcctccctta gaatamtaat tcgtactgaa ttaggtagcc caggaacatt aattggcaat 60 gatcaaattt acaactcaat tgttactgca catgccttta ttataatttt ttttatagta 120 atgcctgtta tgattggtgg atttggaaac tgattaattc ctcttatact aggagctcct 180 gatatagctt tccctcgtct taataatata agtttttgac ttctccctcc ttctttaact 240 ttacttttaa taagaagtat tgttgataaa ggagcaggaa caggctgaac tgtttatccc 300 cccttatctt ctaatattgc ccatgaaggc gcatctgtag atttagctat cttcagtcta 360 catatagctg gaatctcttc tattttaggg gcaataaatt ttatttcaac tgtaattaat 420 atacgaccta taggattaaa ttctgatcga atacctttat ttatttgagc agtaaaaatc 480 acagcaattc ttctattatt atcattacca gttcttgctg gagcaatcac tatattatta 540 acagaccgta atattaatac ctcatttt 568 // ID LN889489; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889489; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Eupanteos sp. n. 1 MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3499 XX KW . XX OS Eupanteos sp. n. 1 MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Anthribidae; OC Anthribinae; Sintorini; Eupanteos; unclassified Eupanteos. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 358cc12ad1b4ae333682df5e91103025. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Eupanteos sp. n. 1 MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC3499" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738349" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L213" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L213" FT /protein_id="CUR50320.1" FT /translation="MLGTSLSILIRTELGNPGSLIGDDQIYNVIVTAHAFIMIFFMVMP FT TMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLMSSMVESGAGTGWTVYPP FT LSSNIAHGGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPKGMTFDRMPLFVWAVGI FT TALLLLLSLPVLAGAITMLLTDRNLNTSF" XX SQ Sequence 577 BP; 166 A; 92 C; 87 G; 230 T; 2 other; atattaggaa cttccttaag aattttaatt cgtactgaat taggaaatcc aggatcttta 60 attggagatg accaaattta taatgttatt gttactgctc atgctttcat tataattttt 120 tttatggtaa taccaacaat aattggcgga tttggaaatt gattagtccc cttaatatta 180 ggagctcctg atatagcttt tcctcgaata aataatatga gattttgact tttacctcct 240 tcattaactc ttttattrat gagaagaata gttgaaagag gtgctggaac tggttgaaca 300 gtttatcctc ctttatcatc taacattgct catggtggtt catctgttga tttagcaatt 360 tttagtcttc acctagcagg aatctcctct attttaggtg ctgttaattt tattactaca 420 attattaata trcgaccaaa aggaataaca tttgaccgta tacctctttt tgtatgagct 480 gttggtatta ctgctttatt acttcttctt tcattacctg ttctagcagg ggcaattaca 540 atattattaa ctgatcgaaa cttaaataca tcttttt 577 // ID LN889490; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889490; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Storeus sp. ARC3500 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3500 XX KW . XX OS Storeus sp. ARC3500 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Storeus; unclassified Storeus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 45c8d333461302e554436235f369bb44. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Storeus sp. ARC3500" FT /organelle="mitochondrion" FT /isolate="ARC3500" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736950" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZI6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZI6" FT /protein_id="CUR50321.1" FT /translation="MVGTSLSMLIRTELGNPGSLIGDDQIYNTIXTAHAFIMIFFMVMP FT TMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLVLLLMSSIVNKGAGTGWTVYPP FT LSGNVAHEGASVDLAIFSLHMAGISSILGAVNFISTVMNMRPTGMKPDQMSLFIWSVKI FT TAILLILSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 178 A; 108 C; 89 G; 200 T; 2 other; atagtgggta cctcactaag tatattaatt cgaacwgaat taggaaaccc tggaagatta 60 atcggtgatg atcaaattta taatactatt gktactgcac atgcttttat tataattttt 120 tttatagtaa taccaactat aattggcgga ttcggaaatt ggctagttcc tctgatacta 180 ggagctcctg atatagcatt cccgcgactt aacaatataa gattttgact tttacccccc 240 tcattagttc ttcttctaat aagaagaatt gtaaacaaag gagcaggaac tggatgaaca 300 gtttatcccc ctctttcagg aaatgtggcc catgaaggtg catctgtaga tttggcaatc 360 ttcagtctac atatagctgg aatctcctct atcttaggag ctgtaaattt tatttctact 420 gttataaata tacgacctac cggaataaaa cctgatcaaa tatcattatt catttgatct 480 gttaaaatta cagctattct tttaatttta tcccttccag tgttagcagg tgctatcact 540 atattattaa cagaccgaaa tatcaacact tcctttt 577 // ID LN889491; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889491; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Cryptoderma sp. ARC3501 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3501 XX KW . XX OS Cryptoderma sp. ARC3501 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Dryophthorinae; Cryptoderma; unclassified Cryptoderma. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; d1b1d86447ccddbf4e789c6579801443. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Cryptoderma sp. ARC3501" FT /organelle="mitochondrion" FT /isolate="ARC3501" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736962" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L6I8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L6I8" FT /protein_id="CUR50322.1" FT /translation="MIGTSLSILIRAELGSPGSLIGDDQIYNVIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVEKGAGTGWTVYPP FT LSGNIAHSGASVDLAIFSLHMAGISSILGAINFISTVINMRPSGMSSDRLTLFSWAVSI FT TALLLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 153 A; 138 C; 100 G; 186 T; 0 other; ataatcggta cctcattaag aattttaatc cgagctgaat taggcagccc aggctcccta 60 attggagatg accaaatcta taatgttatt gtaacagctc atgctttcat cataattttc 120 tttatggtta tgcctattat aattggaggt ttcggaaatt ggttagttcc cttaatacta 180 ggggcccctg acatggcctt tccacgtctt aataatataa gattttggct cctcccaccc 240 tctctaactc ttcttttaat gagaagaatc gtagaaaagg gggcaggcac cggatgaact 300 gtgtaccccc ctctctcagg aaatatcgcc catagagggg catcagtcga tctagctatt 360 tttaggctac atatagcagg aatctcctct atcctaggag caattaactt tatctctaca 420 gtaattaaca tacgtcccag aggaatgtcc tctgaccgtc tcactctctt ttcatgggct 480 gtaagaatca ctgccttact tttgctttta tcactcccag tattagccgg agccatcacc 540 atacttttaa ctgaccgtaa tattaatacc tcctttt 577 // ID LN889492; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889492; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Demimaea cf. strumosa MB-2015 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3502 XX KW . XX OS Demimaea cf. strumosa MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Tychiini; Demimaea. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 4f08f4d1f6847f1b17cb2015587789e1. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Demimaea cf. strumosa MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC3502" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738345" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZC0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZC0" FT /protein_id="CUR50323.1" FT /translation="MIGTSLSMLIRTELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT MMIGGFGNWLIPLMLGAPDMAFPRLNNMSFWLLPPSLLLLLMSSIVDKGVGTGWTVYPP FT LSANIAHEGTSVDLAIFSLHMAGISSILGAINFISTIANMHPTGMKFEQLTLFTWAVKI FT TAILLLLSLPVLASAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 193 A; 93 C; 76 G; 215 T; 0 other; ataattggta catctttaag aatattgatt cgtacagaat taggaaatcc aggaagatta 60 attggagatg atcaaattta taatacaatt gtcacagcac atgcttttat tataattttt 120 ttcatagtta taccaataat aattggagga tttggaaatt gattaattcc tttaatatta 180 ggtgcacctg atatagcttt ccctcgatta aataatataa gattttgact tcttccccca 240 tccttattac ttctattaat aagtagaatt gttgataaag gagtaggaac aggctgaact 300 gtatatcccc ctttatcagc aaatattgct catgaaggaa catctgtaga tctagctatc 360 tttagtcttc atatagctgg aatttcatca attttaggag ctattaactt catttcaact 420 attgctaata tacatcctac tggaataaaa tttgaacaac taaccctttt tacctgagct 480 gtaaaaatca cagctatttt attattatta tctcttcctg ttttagccag agctattaca 540 atattattaa cagatcgaaa tattaataca tctttct 577 // ID LN889493; SV 1; linear; genomic DNA; STD; INV; 437 BP. XX AC LN889493; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Trachodes hispidus mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3510 XX KW . XX OS Trachodes hispidus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Molytinae; Trachodini; Trachodes. OG Mitochondrion XX RN [1] RP 1-437 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; a2633ffb371f28c566b259f623076d4d. XX FH Key Location/Qualifiers FH FT source 1..437 FT /organism="Trachodes hispidus" FT /organelle="mitochondrion" FT /isolate="ARC3510" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:202221" FT CDS <1..>437 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4Q9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4Q9" FT /protein_id="CUR50324.1" FT /translation="MVGTSLSMMIRTELGTPGSVIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPVMAFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPP FT LSTNIAHEGMSVDLAIFSLHLAGXSSILGAMNFISTVINMHP" XX SQ Sequence 437 BP; 138 A; 81 C; 65 G; 152 T; 1 other; atagtaggta cttccttaag aataataatt cggacagaat taggaacccc gggaagagta 60 attggtaatg atcaaattta taatactatt gttacagctc atgcttttat tataattttt 120 tttatagtta tacctattat aatcggagga tttggtaatt gattagtacc attaatactt 180 ggagccccag tcatagcttt cccccgttta aacaatataa gattttgact tttacctcct 240 tccttaactt tattattaat aagaagcatt attgataaag gagcaggaac aggttgaaca 300 gtgtacccac ccctatctac aaatatcgct catgaaggaa tatctgtcga tcttgctatc 360 ttcagattac accttgctgg artttcctct attctaggag caataaactt tatctccaca 420 gttattaata tacaccc 437 // ID LN889494; SV 1; linear; genomic DNA; STD; INV; 508 BP. XX AC LN889494; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pantorhytes huonarius mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3512 XX KW . XX OS Pantorhytes huonarius OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Entiminae; Pachyrhynchini; Pantorhytes. OG Mitochondrion XX RN [1] RP 1-508 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f2e01ba84012954528dd6a779c70f689. XX FH Key Location/Qualifiers FH FT source 1..508 FT /organism="Pantorhytes huonarius" FT /organelle="mitochondrion" FT /isolate="ARC3512" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1671690" FT CDS <1..>508 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZX5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZX5" FT /protein_id="CUR50325.1" FT /translation="DQIYNVIVTAHAFIMIFFMVMPMMIGGFGNWLVPLMLGAPDMAFP FT RLNNMSFWLLPPSLTFLLTSSIVDKGAGTGWTVYPPLSANIAHEGASVDLAIFSLHMAG FT VSSILGAINFISTIINMRPAGMSLDRTPLFVWSVKITAILLLLSLPVLAGAITMLLTDR FT NINTSF" XX SQ Sequence 508 BP; 151 A; 87 C; 78 G; 192 T; 0 other; gaccaaatct ataacgttat tgtaacagct catgctttta ttataatttt ttttatagtt 60 atgcccataa taattggggg atttggaaat tgattagttc ctttaatact aggggcccca 120 gatatagctt ttccacgatt aaataatata agattttgac ttttaccacc ttcattgaca 180 tttcttttaa caagaagaat tgtcgataaa ggagctggta caggttgaac agtttatccc 240 cctctttcag caaatattgc tcatgaagga gcttcagttg atttagcaat ctttagtctt 300 catatagcag gagtttcttc aattttagga gcaattaatt ttatctcaac aattattaat 360 atacgcccag ctggaataag ccttgatcgg actcctttat ttgtatgatc tgtaaaaatt 420 acagcaattc tcttactttt atctcttccg gttcttgctg gggcaattac tatattatta 480 actgatcgta atattaacac aagatttt 508 // ID LN889495; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889495; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ottistira dani mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3513 XX KW . XX OS Ottistira dani OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Entiminae; Celeuthetini; Ottistira. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; f0a0214910721db392f935e4a8e58655. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ottistira dani" FT /organelle="mitochondrion" FT /isolate="ARC3513" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1671837" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L482" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L482" FT /protein_id="CUR50326.1" FT /translation="MIGTSLSMLIRTELGNPGSLIGDDQIYNVIVTAHAFIMIFFMVMP FT MMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIIDSGAGTGWTVYPP FT LSANIAHGGSAVDLAIFSLHMAGISSILGAVNFISTIMNMRPKGMNLDQMTLFIWSVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 177 A; 116 C; 88 G; 196 T; 0 other; ataattggta cctcattaag aatacttatt cgaacagaat taggaaaccc cggatcttta 60 attggagatg atcaaatcta taacgttatt gtgacagctc atgcttttat tataattttt 120 tttatagtta taccaataat aattggggga ttcggaaatt gactagtacc cctaatatta 180 ggagcccctg atatagcttt cccccgactt aataatataa gattttggct tttacctcct 240 tccctaactc ttcttttaat gagaagaatt attgatagag gggcaggaac aggatgaacc 300 gtttatccgc cactctctgc aaatattgcc cacgggggat ctgctgtaga ccttgcaatt 360 ttcagattac atatagctgg aatttcttca attctagggg cagtaaattt tatttctaca 420 attataaata tacgacccaa gggtataaat ctagatcaaa taactctttt tatttgatca 480 gtaaaaatta ctgcaatcct cctacttctt tctcttccag tattagccgg agctatcacc 540 atacttctca cagaccgaaa catcaatacc tcatttt 577 // ID LN889496; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889496; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Storeus sp. ARC3515 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3515 XX KW . XX OS Storeus sp. ARC3515 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Storeus; unclassified Storeus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 6cfb2e87884e6a4d9022024cd75093af. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Storeus sp. ARC3515" FT /organelle="mitochondrion" FT /isolate="ARC3515" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736951" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4KZL0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4KZL0" FT /protein_id="CUR50327.1" FT /translation="TVGTSLSMLIRTELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMP FT TMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSIILLLMSSIVNKGAGTGWTVYPP FT LSANVAHEGASVDLAIISLHMAGISSILGAINFISTIMNMRPSGMKPDRMSLFVWSVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 193 A; 102 C; 81 G; 201 T; 0 other; acagtaggga cttctttaag aatattaatt cgaacagaac ttggaaaccc aggaagtcta 60 attggagacg accaaattta taatactatt gttacagccc atgcttttat tataattttt 120 tttatagtaa tacctaccat aattggtgga tttggaaatt gactcgtacc ccttatatta 180 ggagcccctg atatagcatt ccctcgactt aataatataa gattttgact attaccacca 240 tcaattattt tactattaat aagaagaatt gtaaataaag gagcaggaac aggatgaaca 300 gtttatccac ctttatcagc aaatgtagcc catgaaggag catctgttga tttagctatt 360 attagattac atatagcagg aatttcctcc attttaggag caattaattt tatttctact 420 attataaata tacgaccatc tggaataaaa ccagatcgta tatcactttt tgtatgatct 480 gtaaaaatta cagcaattct tcttcttctt tctctaccag tattagcagg agccatcact 540 atactactta ctgaccgtaa tattaataca tcttttt 577 // ID LN889497; SV 1; linear; genomic DNA; STD; INV; 550 BP. XX AC LN889497; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Imathia sp. ARC3517 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, isolate ARC3517 XX KW . XX OS Imathia sp. ARC3517 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Storeini; Imathia; unclassified Imathia. OG Mitochondrion XX RN [1] RP 1-550 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 9799dee416563d962d0405512f631ed2. XX FH Key Location/Qualifiers FH FT source 1..550 FT /organism="Imathia sp. ARC3517" FT /organelle="mitochondrion" FT /isolate="ARC3517" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736976" FT CDS <1..>550 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L2E3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L2E3" FT /protein_id="CUR50328.1" FT /translation="IRLELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNW FT LIPLMLGAPDMAFPRLNNMSFWLLPPSLFLLLFSSIIDKGVGTGWTVYPPLSNNIAHEG FT ASVDLAIFSLHMAGISSILGAMNFISTILNMRPKGMNPDRMSLFIWAVKITAILLLLSL FT PVLAGAITMLLTDRNINTSF" XX SQ Sequence 550 BP; 174 A; 102 C; 77 G; 197 T; 0 other; attcgactag aattaggaaa tcccggcaga ctaattggag atgaccaaat ttataataca 60 attgtcaccg ctcatgcatt tattataatt ttctttatag ttatgccaat tataattggg 120 ggatttggaa attgactaat tcctttaata ctaggggccc ctgatatagc tttccctcgt 180 ttaaataata taagattttg actactccca ccttctcttt ttttactttt atttagaaga 240 attattgata aaggagtagg aacaggatga acagtatacc cccctttatc aaacaacatt 300 gctcacgaag gagcctcagt agatctagct atttttagtc ttcatatagc tggaatttct 360 tcaattttag gagctataaa ttttatttct acaattttaa atatacgacc taaaggaata 420 aaccctgatc gtatatcttt atttatctga gctgtaaaaa ttacagctat cctattgctt 480 ctatctttac cagttctagc cggtgcaatc acaatacttc ttacagaccg aaatatcaat 540 acatcatttt 550 // ID LN889498; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889498; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ochyromera cf. sericea MB-2015 mitochondrial partial COI gene for DE cytochrome oxidase subunit 1, isolate ARC3518 XX KW . XX OS Ochyromera cf. sericea MB-2015 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Tychiini; Ochyromera. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 5dfb3191e4a07b5d418b95ac1ff55110. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ochyromera cf. sericea MB-2015" FT /organelle="mitochondrion" FT /isolate="ARC3518" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1738361" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L1Z4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L1Z4" FT /protein_id="CUR50329.1" FT /translation="MVGTSLSMLIRTELGNPGKFIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSTNIAHEGSSVDLAIFSLHMAGISSILGAMNFISTVINMRPVGMNLERMSLFIWAVKI FT TAILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 174 A; 106 C; 92 G; 205 T; 0 other; atagtaggaa cttctctaag aatactaatt cggacagaat taggaaaccc aggaaaattc 60 attgggaatg accaaatcta caatactatt gtaactgcgc atgcttttat tataattttt 120 tttatagtta taccaattat aattggagga tttggtaatt gactggtacc gttaatacta 180 ggagcccctg atatagcttt ccctcgactt aataatataa gattctgact tttacccccc 240 tctctaacat tactacttat atctagaatt gtcgataagg gtgcaggcac agggtggaca 300 gtataccccc ccttatctac aaatattgct catgagggct catcagtaga tttagcgatt 360 tttagtcttc atatggctgg aatttcttca attctaggag ctataaattt tatctctacg 420 gttattaata tacgtccagt aggaataaac ctagaacgta tgtctttatt tatttgagct 480 gtaaaaatta cagctatctt gcttcttctc tctttacctg ttttagctgg ggctattaca 540 atactactaa cagatcgaaa tattaatact tcatttt 577 // ID LN889499; SV 1; linear; genomic DNA; STD; INV; 517 BP. XX AC LN889499; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Pseuderodiscus sp. ARC3519 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3519 XX KW . XX OS Pseuderodiscus sp. ARC3519 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Erodiscini; Pseuderodiscus; unclassified Pseuderodiscus. OG Mitochondrion XX RN [1] RP 1-517 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; ba6f83c8fad804e39836f48980100b31. XX FH Key Location/Qualifiers FH FT source 1..517 FT /organism="Pseuderodiscus sp. ARC3519" FT /organelle="mitochondrion" FT /isolate="ARC3519" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1737004" FT CDS <1..>517 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L224" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L224" FT /protein_id="CUR50330.1" FT /translation="IGNDQIYNTIVTAHAFIMIFFMXMPIMIGGFGNWLVPLMLGAPDM FT AFPRLNNMSFWLLPPSLTLLLMSSIIDKGAGTGWTVYPPLSTNIAHEGMSXBLAIFSLH FT LAGISSILGAMNFISTIINMHPIGMKLDQLPLFVWSXKITAILLLLSLPVLAGAITMLL FT TDRNINTTF" XX SQ Sequence 517 BP; 152 A; 104 C; 63 G; 194 T; 4 other; attggtaatg accaaatcta taatacaatc gtaactgctc atgcttttat tataattttt 60 tttataktaa taccaattat aattgggggc tttggaaact gactcgtccc tcttatacta 120 ggtgctcctg atatagcatt ccctcgtctt aataatataa gattctgact tttacctcca 180 tctctaacct tacttttaat aagaagaatt attgataaag gggccggaac cggttgaaca 240 gtgtatcccc ctctttctac taatattgcc catgagggca tatcartara tctagcaatt 300 tttagccttc acttagctgg tatctcctct atccttggtg ctataaattt tatttctact 360 attattaata tacacccaat tggtataaaa cttgaccaat tacctttatt tgtctgatca 420 ktaaaaatta ccgcaattct cttactactt tctttacctg tattagctgg tgcaatcact 480 atattattaa cagatcgaaa tattaacaca acttttt 517 // ID LN889500; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889500; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Lepidimerodes sp. ARC3520 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3520 XX KW . XX OS Lepidimerodes sp. ARC3520 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Curculioninae; Tychiini; Lepidimerodes; unclassified Lepidimerodes. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 390fa4bda4267a577df6e7af05422a8a. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Lepidimerodes sp. ARC3520" FT /organelle="mitochondrion" FT /isolate="ARC3520" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: LCO1490-JJ, fwd_seq: FT chacwaaycataaagatatygg, rev_name: HCO2198-JJ, rev_seq: FT awacttcvggrtgvccaaaraatca" FT /db_xref="taxon:1736978" FT CDS <1..>577 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A0S4L4G9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0S4L4G9" FT /protein_id="CUR50331.1" FT /translation="MVGTSLSMLIRTELGNPGKFIGNDQIYNTIVTAHAFIMIFFMVMP FT IMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSIVDKGAGTGWTVYPP FT LSANIAHEGSSVDLAIFSLHMAGISSILGAMNFISTIMNMRPTGMKLERMSLFIWAVKI FT TTILLLLSLPVLAGAITMLLTDRNINTSF" XX SQ Sequence 577 BP; 192 A; 90 C; 81 G; 214 T; 0 other; atagttggta catcattaag aatgcttatt cgaacagaac taggtaatcc aggtaaattt 60 attggaaatg atcaaattta taatacaatt gttactgctc atgcttttat tataattttt 120 tttatagtta taccaattat aattggagga ttcggaaatt gacttgtacc attaatatta 180 ggagctcctg atatagcttt tcctcgttta aataatataa gattttgact tttaccacct 240 tcactaactc ttcttttgat atcaagaatt gtagataaag gggctggaac aggatgaacg 300 gtttatccgc ctttatcagc aaatattgcc catgaaggat cctcagtaga cttagcaatt 360 tttaggcttc atatagcagg tatctcatca attttaggag caataaattt tatttcaaca 420 attataaata tacgacctac tggaataaaa ttagaacgta tatccttatt tatttgagca 480 gtaaaaatta ctactatttt attactacta tctttaccag tacttgctgg agcaattact 540 atacttctta cagaccgtaa tattaataca tcatttt 577 // ID LN889501; SV 1; linear; genomic DNA; STD; INV; 577 BP. XX AC LN889501; XX DT 29-NOV-2015 (Rel. 127, Created) DT 29-NOV-2015 (Rel. 127, Last updated, Version 1) XX DE Ochronanus sp. ARC3525 mitochondrial partial COI gene for cytochrome DE oxidase subunit 1, isolate ARC3525 XX KW . XX OS Ochronanus sp. ARC3525 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cossoninae; Ochronanus; unclassified Ochronanus. OG Mitochondrion XX RN [1] RP 1-577 RA Balke M.; RT ; RL Submitted (08-OCT-2015) to the INSDC. RL ZSM, Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Taenzler R., Van Dam M.H., Toussaint E.F.A., Suhardjono Y.R., Balke M., RA Riedel A.; RT "Macroevolution of hyperdiverse flightless beetles reflects the complex RT geological history of the Sunda Arc"; RL Unpublished. XX DR MD5; 7ffe07a8595f276bbcfc6cffc7116d43. XX FH Key Location/Qualifiers FH FT source 1..577 FT /organism="Ochronanus sp. ARC3525" FT /organelle="mitochondrion" FT /isolate="ARC3525" FT /mol_type="genomic DNA" FT /P