ID EP498447; SV 1; linear; genomic DNA; CON; ENV; 820 BP. XX AC EP498447; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549750 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-820 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-820 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-820 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-820 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a7b021ec9bfc9182f4ca06884a51dd4f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..820 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>819 FT /locus_tag="GOS_263898" FT CDS <1..>819 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263898" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701385120; CAM_CL_740" FT /inference="protein motif:Pfam (release 17):PF01619.6" FT /protein_id="EBB25650.1" FT /translation="LKLNLPIKWILKRTIYKHFCGGVDLVECKEIINEMYTMNVHSILD FT YSVEGQKNELSFDKSCKKKIDIIDSVSKNKAIPFAVFKPTSIGRYDLFKMVTNQNQLNK FT TENDEWLNVVARFHKICKHAMKMNIKILIDAEEYEVQKAIDNLSLEMMINYNINDVIVY FT NTIQLYRWDRLDYLKKILKKYSASEFNFGFKLVRGAYMEKERLMAKKGKYKSPICSTKN FT DTDKNFDNAVELMFDNLKKIDFFVATHNENSNYKVMKLMKKNGLQNSTNKI" XX CO join(AACY024077561.1:1..820) // ID EP498448; SV 1; linear; genomic DNA; CON; ENV; 897 BP. XX AC EP498448; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549752 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-897 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-897 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-897 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-897 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 242eb0741bcd80519c423726481ed527. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..897 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..233) FT /locus_tag="GOS_263900" FT CDS complement(<1..233) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263900" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096700856016; CAM_CL_490" FT /protein_id="EBB25649.1" FT /translation="MLASAPESILKDKNRPFNGKEYISSLQDDREIYIYGERVKDVTKH FT PAFRNSVQSIAKLYDALHEDSTKKILTTETDTG" FT gene 355..>897 FT /locus_tag="GOS_263899" FT CDS 355..>897 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263899" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096700856012; CAM_CL_6125" FT /inference="protein motif:Pfam (release 17):PF05853.2" FT /protein_id="EBB25648.1" FT /translation="MEMPLDTTKEVFITCAVTGSGASHNKSDLVPRSPKEIAESAIEAA FT RAGAAIVHCHVRDPKSGEPARLPSLYKEVTDRIRESDTDVIINLTAGMGGDVVFGPADS FT PLPLRDGTDMVSAEERMEHILECQPEICTLDCGTMNFSDDVMANTPAILRAMAKIATDA FT DVRIEIEAFDTGHIWFAK" XX CO join(AACY024077562.1:1..897) // ID EP498449; SV 1; linear; genomic DNA; CON; ENV; 968 BP. XX AC EP498449; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549761 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-968 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-968 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-968 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-968 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 866daa17124ecea4c92b7666da4c59ca. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..968 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 175..>968 FT /locus_tag="GOS_263901" FT CDS 175..>968 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263901" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701325496; CAM_CL_183" FT /inference="protein motif:Pfam (release 17):PF00892.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00950" FT /protein_id="EBB25647.1" FT /translation="MIKIFPFIFILLWSSAFITTKPIIDNSDPFAALAFRFALVALGFF FT IFSIYSKEKILISRKNFFESFLSGVLFHGFYLGGVFYSISIGMPTGIAALIVTLQPILT FT NALSGPILNEKVSKKQWIGVLLGFSGAAIVLGFDIGSKIPTVGLLATIIALLAITFSTL FT WQKKLSNNLPLSVSNMNQALGGCIFHLLIIILFAKPYIDFSQTFIIAMSHQIFLVSFGA FT FTILMYLIKNNSASKTVSIFFLIPATSAFMAWLFLNENLTAL" XX CO join(AACY024077563.1:1..968) // ID EP498450; SV 1; linear; genomic DNA; CON; ENV; 1019 BP. XX AC EP498450; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549777 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1019 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1019 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1019 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1019 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 498c963c0a04b7affb583c4611d9bb99. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1019 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>1018 FT /locus_tag="GOS_263903" FT CDS <1..>1018 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263903" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701155342; CAM_CL_408" FT /inference="protein motif:Pfam (release 17):PF00521.9" FT /inference="protein motif:Pfam (release 17):PF03989.2" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01061" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01062" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01063" FT /protein_id="EBB25646.1" FT /translation="KGRSAIVVKELPYQASIDRIMEKIASLVQDKKLAGVSDLRNESSD FT RNGTRLVIELKRDAVPQVVLNQLFKQTQLQDSFSVNSVALVDGVPKVLSVPELIGYYIK FT HQIDVIQRRTKHRLDKAKDRLHIVEGLLLALNKIDQIIKTIKASKDVDIARKSLMKKFK FT LSKIQASHILDMPLRRLTALEREKLDEEKKDLKETIKELTAILKSRAKQNKILVEELEA FT ITEKFGDERRSRLVDDVGEVKIEDLIEDEEIIVSVSSGGYVKSVPSDSYKKQGRGGKGV FT KASSSDEDVIEHLLSTSVHSYLLFFTDKGKVYRAKAHELPKTTRTAKGSLIHNVLQWV" XX CO join(AACY024077564.1:1..1019) // ID EP498451; SV 1; linear; genomic DNA; CON; ENV; 933 BP. XX AC EP498451; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549787 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-933 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-933 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-933 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-933 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 04bdae64ff01c8fd1f54ffc8560b71f7. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..933 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..437) FT /locus_tag="GOS_263910" FT CDS complement(<1..437) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263910" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701085588; CAM_CL_1733" FT /inference="protein motif:Pfam (release 17):PF00440.10" FT /protein_id="EBB25645.1" FT /translation="MFFDHIYFLPLGRQCYNLFVKTSDRILVAATVAFGENGYDGTSLD FT SLAQELGIRKQSILYHYPTKEALLDATVADAIQVLALALSDAVTKSGDGWDRIEKMVRR FT VFRLAIQRPELLGLLREVSRLGPPALTKAVKDFDPLIKGAT" FT gene 423..>933 FT /locus_tag="GOS_263908" FT CDS 423..>933 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263908" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701085586; CAM_CL_3491" FT /inference="protein motif:Pfam (release 17):PF01370.9" FT /inference="protein motif:Pfam (release 17):PF07993.1" FT /protein_id="EBB25644.1" FT /translation="MIKEQLAGKKIAITGSTGFLGTALVEQLLRTIPDVKLVLLVRSSK FT RTASQRVKREILNNDAFGPLRKELGDEEFDRLTRDQIDAVSADIALDHLGLDEQGKETL FT KGCDIVIHSAAAVSFDEPLDRAVEVNLMGPVRLVALLKELNINPHLVMVSTCYVAGSRK FT GDAPEQA" XX CO join(AACY024077565.1:1..933) // ID EP498452; SV 1; linear; genomic DNA; CON; ENV; 994 BP. XX AC EP498452; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549790 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-994 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-994 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-994 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-994 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ebbe9911697ff6c33077f7b595871efb. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..994 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 81..932 FT /locus_tag="GOS_263911" FT CDS 81..932 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263911" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701405792; CAM_CL_1647" FT /inference="protein motif:Pfam (release 17):PF00775.10" FT /inference="protein motif:Pfam (release 17):PF04444.3" FT /protein_id="EBB25643.1" FT /translation="MINFMRDFNEITATEGVLKSFDSIENKRVKILMGSIVNHLHEVVK FT ETEPTFEEWLKAIDFLTRTGQKCDERRQEFILFSDVLGISMLIDTINNRKNNNETESTV FT LGPFHAPAPDIRFGDNIAHHVKGEKCLVKGKVSDINGKVIPDAIVDVWQSGPDGLYDVQ FT KENNVVDLRGKMKTNKNGEYFFKTVKPQFYPVPTDGPVGEILNLMGRHPFRPAHIHFMI FT KAEGYVDLTTHVFIDGDPYLDSDTVFAVKESLIRKLNDAIDPDDNTQCKELTFDIILEK FT KK" XX CO join(AACY024077566.1:1..994) // ID EP498453; SV 1; linear; genomic DNA; CON; ENV; 956 BP. XX AC EP498453; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549800 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-956 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-956 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-956 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-956 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ca19dbb851e31de39499116a99beac75. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..956 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(125..>956) FT /locus_tag="GOS_263913" FT CDS complement(125..>956) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263913" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701606946; CAM_CL_3177" FT /inference="protein motif:Pfam (release 17):PF07690.3" FT /protein_id="EBB25642.1" FT /translation="GIQPAAVAYMSDSTDSSNRTKAMALIGMASGIGTMIGPVMGGSLS FT FIHPLFPMYCGAGIALIGAILAQKYLIHSVPEISEVNQNKSLKFYDSRVLPFLIGWSVA FT FMVFTSVQIISAFFIQDQLGISDPDQVIKFTSIALLSMALTSTFMQAVVLQVINISTQT FT LLRICFLIFGMILISISVVDSLTEFFLAYAGMGIAFSMITPSLNAAATLSVEPSEQGEV FT AGFLAGAPVVGMIFGPTIGTLLYNLDPTFPFYYGGLGAIILGVYFQFVRVSEDH" XX CO join(AACY024077567.1:1..956) // ID EP498454; SV 1; linear; genomic DNA; CON; ENV; 955 BP. XX AC EP498454; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549806 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-955 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-955 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-955 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-955 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 3b5ee11445e29eee24f7a9fbe8f76364. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..955 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(189..>955) FT /locus_tag="GOS_263914" FT CDS complement(189..>955) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263914" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701824648; CAM_CL_100" FT /inference="protein motif:Pfam (release 17):PF00528.10" FT /protein_id="EBB25641.1" FT /translation="FTTLPIIWIFFISIKSKNDSFTRPPKFFFEPIIDNYTKTINNEFF FT RETFFNSLLITFFGIILSVVIAIFAAYALKRYQIRFKKTFMQWLLLAYMLPEFLFVLPM FT YSIYQTLGLYDTHFGLALMYQVHALPFSIWMLRSFLEEIPKEIDDAALIDGCSPFQTIY FT KIYIPLILPGIVATAILNGIWMWNELAIAIGLTFSEAHPITLGVAQFRGYASKDWGGMT FT ASSILALIPMIFFVIIAQKHIVKGLTLGSLKG" XX CO join(AACY024077568.1:1..955) // ID EP498455; SV 1; linear; genomic DNA; CON; ENV; 999 BP. XX AC EP498455; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549809 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-999 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-999 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-999 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-999 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8af2eef4d232cf894b029d36c3f554ca. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..999 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>999) FT /locus_tag="GOS_263915" FT CDS complement(<5..>999) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263915" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701764768; CAM_CL_2627" FT /inference="protein motif:Pfam (release 17):PF00310.10" FT /inference="protein motif:Pfam (release 17):PF01380.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01134" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01135" FT /protein_id="EBB25640.1" FT /translation="GHVRWATHGVPNKVNAHPHSSEIVSVVHNGIIENSDQLKKEFEKS FT GTTFKSQTDTEVITVLLTEKLEKLDPLKAVFETIDMLKGSFALGIIFRNHKEFVIGARR FT GSPLAVGYSNNENYLGSDSYALKSMTNKISYLDDGDVCVLSKDEVKFYNHNKDKINKEI FT FTLSEDKASVTKGNYKNFMIKEIFDQPVTTKTCLKEYIDKIREEINFYNLPLDPKEIKK FT IVLIGCGTAYHSCLVAKYWFEEFSSINIEVDIASEFRYRKVRFDKKALYIFVSQSGETA FT DTYAALDLCKKQNVKTCSVINVVESSIARNSDCVLPIHAGPEIGVASTKA" XX CO join(AACY024077569.1:1..999) // ID EP498456; SV 1; linear; genomic DNA; CON; ENV; 928 BP. XX AC EP498456; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549816 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-928 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-928 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-928 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-928 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 90bb3b7abe386c2d824af1c1947dee36. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..928 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>928) FT /locus_tag="GOS_263919" FT CDS complement(<6..>928) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263919" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096700936326; CAM_CL_4122" FT /inference="protein motif:Pfam (release 17):PF02353.8" FT /protein_id="EBB25639.1" FT /translation="CVHREVLDGMETGMARLVQPLRQLLHSKNRNTESGSRRNIRAHYD FT LGNNFFREFLDETMTYSAGIFDKPESTLKEASIAKYDRLCRKLSLSPEDHVIEIGSGWG FT GFAIHAAQNYGCKITTTTISEEQYTLGKLRIQEAGLGDRITILLQDYRKLTGTFDKLVS FT IEMIEAVGHHYFESFFNQCSHLLAPHGLAAIQAITIQDRFYESARKEVDFIKRYIFPGS FT CIPSITALSTAASITDLRLVHLEDLTPHYAETLRRWRARFLGRWDRIEAQGFDEYFKKI FT WEFYFCYCEGGFDEAALGSLQFLYAK" XX CO join(AACY024077570.1:1..928) // ID EP498457; SV 1; linear; genomic DNA; CON; ENV; 982 BP. XX AC EP498457; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549818 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-982 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-982 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-982 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-982 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; d6fe6ad6c5b0af43a8887a6c16f162a5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..982 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077571.1:1..982) // ID EP498458; SV 1; linear; genomic DNA; CON; ENV; 930 BP. XX AC EP498458; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549827 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-930 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-930 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-930 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-930 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ea0e1f5d0308bbd47a392b235b6e7127. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..930 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..309) FT /locus_tag="GOS_263921" FT CDS complement(<1..309) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263921" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701741216; CAM_CL_3291" FT /inference="protein motif:Pfam (release 17):PF02874.9" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01039" FT /protein_id="EBB25638.1" FT /translation="MRSRKFIIMRKGKITQVIGAVVDVKFDGELPEILTALECNNAGNR FT LVLEVAQHLGESSVRTIAMDATEGLKRGDEVTDTGSPIKVPVGPETLGRIVNVIGEPI" FT gene complement(288..>930) FT /locus_tag="GOS_263920" FT CDS complement(288..>930) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263920" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701741212; CAM_CL_1385" FT /inference="protein motif:Pfam (release 17):PF00231.8" FT /protein_id="EBB25637.1" FT /translation="HLCVVLTSDRGLCGGFNTNIIKKAKQYFQKILKENKILKIITVGS FT KGYDQLKRQYKENIIEKISFKDSKNINYFDADKVGKIIIDRFEKKEFDVCAIFYNQFKN FT VITQIPQEQQIIPLKSNEEKETSSNDSYEFEPEEDEILSNLLPKNISTQIFKAMLENSA FT SEQGSRMSAMDNATRNAGEMVDKLTIQYNRSRQAAITKELIEIISGAESL" XX CO join(AACY024077572.1:1..930) // ID EP498459; SV 1; linear; genomic DNA; CON; ENV; 964 BP. XX AC EP498459; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549829 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-964 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-964 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-964 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-964 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; bb0b0e1f04537aafdf8ab8ccc5c2c0c8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..964 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..190) FT /locus_tag="GOS_263927" FT CDS complement(<1..190) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263927" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701425436; CAM_CL_1247" FT /inference="protein motif:Pfam (release 17):PF01264.10" FT /protein_id="EBB25636.1" FT /translation="MAGNTIGKLFTVTTSGESHGPGLSAIIDGCPPGLAISEKDIQKEL FT NKRRPGQSRFTSQRKETE" FT gene complement(218..>964) FT /locus_tag="GOS_263923" FT CDS complement(218..>964) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263923" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701425430; CAM_CL_6666" FT /inference="protein motif:Pfam (release 17):PF01170.8" FT /inference="protein motif:Pfam (release 17):PF05175.3" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00536" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00537" FT /protein_id="EBB25635.1" FT /translation="SKSSDVLNEAELKIALDDQIREKVKEVLYQRIIESKPLPYITNEA FT YFCGKQFYVDERVLIPRSPIAELINNHFEPWINSTTLNRVLEIGTGSGCIALSIAEAFS FT NVEVVATDISTDAIDVALRNAKAYGLENRVEIIESDLFENVSGVFDLIITNPPYVPDEI FT MLDLPKEYLHEPHMALAAGDKGLDFISRILHDAPPFLSHNGIVIIEAGVASENMEQRFD FT MPFIWIDFEIGGEGVAMIEASNLRIE" XX CO join(AACY024077573.1:1..964) // ID EP498460; SV 1; linear; genomic DNA; CON; ENV; 874 BP. XX AC EP498460; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549831 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-874 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-874 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-874 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-874 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 11a1f7f9c003278d3d6ab49d7ace1c94. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..874 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077574.1:1..874) // ID EP498461; SV 1; linear; genomic DNA; CON; ENV; 918 BP. XX AC EP498461; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549839 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-918 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-918 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-918 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-918 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a0b9f0b0ab593a2614abc04e924364c5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..918 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..405 FT /locus_tag="GOS_263928" FT CDS <1..405 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263928" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701506670; CAM_CL_1720" FT /protein_id="EBB25633.1" FT /translation="PIIGYYNQILPGIPDEVYRTIPGTRNSGRYSPYSRLDLGFVYHTK FT VLGSKMDIYVQIINIFNRKNIFRKSYNVGSIYNGIDDDRDWDEDKHDANGNGVPDVGEV FT NVDEEDEGRLQVNNISLFPIIPTIGFSWEF" FT gene 406..>918 FT /locus_tag="GOS_263929" FT CDS 406..>918 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263929" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701506668; CAM_CL_11025923" FT /protein_id="EBB25634.1" FT /translation="MVNKIKLSIQIFTLSFLVQSCSFDDDTISYEEKLVVFASIDAGFP FT VFDTVFVSRTADISESVDATDLYIEDASVKLINMSDGSELKFYSVGNGRYYPIDLSMQN FT IDSISRHWLGYIISSGTTYRLVVSHEEDSVIAQTNVPEKIEITPASMSDFICPDETTEP FT VSIIDVNN" XX CO join(AACY024077575.1:1..918) // ID EP498462; SV 1; linear; genomic DNA; CON; ENV; 953 BP. XX AC EP498462; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549842 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-953 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-953 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-953 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-953 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 69975da76ca4f90c8f4e964520b41c49. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..953 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>953) FT /locus_tag="GOS_263930" FT CDS complement(<5..>953) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263930" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701659402; CAM_CL_5170" FT /inference="protein motif:Pfam (release 17):PF04069.2" FT /protein_id="EBB25632.1" FT /translation="ITREEKMKKLILGLIFSSIMLVTTSAKAAGEKVMISDLSWTGAKV FT IGHIIKAVINGPLNSEAEIVQGLSDGNLIMAGMDKGDGKIDVYTDLWMPNRQGIWDQYI FT DGNKTVAVNTPYKGTQDMYVPAFLKSKVPDVAAMKDPNVAAMFDTDGNGKGEYWAGDAG FT WKSTKMWQVKFKSYGLTDLWEPNIIPQDTFKAQLKDAIDNQKPILFYYWTPEWLHAAYD FT LHEIGEPAYTEGCDSNMNLDAEDWLEVSEFPCKSRQATIYVAYSKSLEKRNPKAAKFLS FT QMAMDPKVINQWILKVGRDEMDADDMAEEWVKNNM" XX CO join(AACY024077576.1:1..953) // ID EP498463; SV 1; linear; genomic DNA; CON; ENV; 1773 BP. XX AC EP498463; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549858 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1773 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1773 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1773 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1773 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a6f19be6c41b95edfccc58189afc2be1. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1773 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..730) FT /locus_tag="GOS_263932" FT CDS complement(<1..730) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263932" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701146276; CAM_CL_4605" FT /inference="protein motif:Pfam (release 17):PF06144.2" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01128" FT /protein_id="EBB25630.1" FT /translation="MICNATSIKKYLDKSPKIFFLYGSEIVLINDSADQINDFFKSKGF FT SERIILTKENFKDAHKIIMQNAGGSLFASKVIIEIIHNSSGTTLPKDILSIFDSQNFDN FT VVIIVRSTIKKVNKNSAWVKLIDSKALIIECNKLKTYEEKAWVKDRLDFMNKSVADEYT FT ERLTSMFAGNLVAQNNEINLLKITYSKNTENKKIEYDDAEFMPYELEGKIIELDTKNAI FT RIIHTIKKNEDHYAQYLVSIV" FT gene complement(720..1202) FT /locus_tag="GOS_263934" FT CDS complement(720..1202) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263934" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701146280; CAM_CL_11133" FT /protein_id="EBB25631.1" FT /translation="MMIVIKIKYFLVLLALVLVVSSCNTSQFQKLDLNNSYYQLTFGKN FT VPLKLKQQAKSVFAKNQQSTSIQNNNIEINNYLFKKYDVYAGNALRALETEISISIDIK FT VKKNDKFISKTIVSTKRFNSIELNPLAEKEMLKFVKEQLINDLIDKLIIEVKLIDL" FT gene complement(1238..1768) FT /locus_tag="GOS_263931" FT CDS complement(1238..1768) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263931" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701146278; CAM_CL_1315" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00396" FT /protein_id="EBB25629.1" FT /translation="MYDINNNFSKEELNLRRKSHATLKKVENDFEVRFSFNTAIAAIME FT LINFIPEDFKSENASDSQKFCLNETIIFTLKMLFPIAPHISEYLWNTFEVEGPNIESSW FT PEFETTLIEAEEFELIIQVNGKVRGRINLNKNSSQDMVEQAALTVENVKNFIGPSEIKK FT TIYVKEKLINFVI" XX CO join(AACY024077577.1:1..1773) // ID EP498464; SV 1; linear; genomic DNA; CON; ENV; 969 BP. XX AC EP498464; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549860 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-969 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-969 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-969 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-969 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ca35e75b3e2bd9f74a3223d48fcc05e6. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..969 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..377 FT /locus_tag="GOS_263935" FT CDS <1..377 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263935" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701177064; CAM_CL_11478304" FT /inference="protein motif:Pfam (release 17):PF04909.3" FT /protein_id="EBB25627.1" FT /translation="TTFGHTVITHPKICAHLLGQIINAFGVDRVLFGTDAIWWGSPQWQ FT IEAFRRFQIPEEMQEKFGYPEITEEDKAKILGLNAAKLYSIDVESSIQKISKDRMTQLK FT NAYLAEGGKPSNNIYGWVMT" FT gene complement(374..>969) FT /locus_tag="GOS_263936" FT CDS complement(374..>969) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263936" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701177062; CAM_CL_3781" FT /inference="protein motif:Pfam (release 17):PF01663.10" FT /protein_id="EBB25628.1" FT /translation="EKIFDQMVRQDQMLGLLFSRLTEIDAWDYVTLLLVSDHGMINVNK FT YISLKDVLDSIEIDYILSAGPAVAHIFIDDKAQRDEALELLSRQDHMIAYRRENLPASF FT HMNHPTRTGDLIVTTEPPYMFNNNPKDGPKGMHGYDPDLREMHAIFGAVGAGVRNERIG FT PIHMTDVAPTIAKLLGIKSVNHMQGRAIDLSPKD" XX CO join(AACY024077578.1:1..969) // ID EP498465; SV 1; linear; genomic DNA; CON; ENV; 960 BP. XX AC EP498465; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549866 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-960 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-960 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-960 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-960 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c3ec77d498328705b0d34a981da22ec5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..960 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..218 FT /locus_tag="GOS_263937" FT CDS <1..218 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263937" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701495698; CAM_CL_538" FT /protein_id="EBB25625.1" FT /translation="TDASTSASKGTFFICTFKIASLPLISGKSTTTCLSNLPGLNKAGS FT RTSGLLVAAITITPSFPSNPSISTNS" FT gene complement(<5..>960) FT /locus_tag="GOS_263938" FT CDS complement(<5..>960) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263938" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701495696; CAM_CL_2458" FT /inference="protein motif:Pfam (release 17):PF00004.16" FT /inference="protein motif:Pfam (release 17):PF06480.3" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01241" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01242" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01243" FT /protein_id="EBB25626.1" FT /translation="QFKQELLSDKIIKVVYKGDQMTIIGDRLDGSKFETTHPIFKKDEA FT VDNAIEEHGVIAVYEKVEQPSIFSQLLVGAFPIILLLAIFFFFMRQMQGGISGKGGPMS FT FGRSKAKLMEGGKVKTTFKDVAGCEEAKQDVSELIDFLKDPTKFQKLGGKIPRGVLMVG FT PPGTGKTLIARAVAGEARVPFFSISGSDFVEMFVGVGASRVRDMFDQAKKQSPCIVFID FT EIDAVGRHRGAGLGGGHDEREQTLNQLLVEMDGFEGNDGVIVIAATNRPDVLDPALLRP FT GRFDRQVVVDLPDIRGREAILKVHMKKVPLDADVDAS" XX CO join(AACY024077579.1:1..960) // ID EP498466; SV 1; linear; genomic DNA; CON; ENV; 1039 BP. XX AC EP498466; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549871 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1039 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1039 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1039 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1039 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; abe7a79dc19c5302af0211e359fcd2fb. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1039 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..503) FT /locus_tag="GOS_263943" FT CDS complement(<1..503) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263943" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701646154; CAM_CL_798" FT /protein_id="EBB25624.1" FT /translation="MEDNRLFNNWNRALLVSLQFPNRSTTEVQNSLQELSSLAYSLGGD FT VAGIIIQVNSQIHPAYFFSKGKLADIKSIIKKDSVDALLVDNQLSPKQIGNLETLLDCT FT VMDRTQLILEIFAKNARTHEAKLQIELAQSEYLLTRLVGLWKHLDRERGGIGASQGTGE FT KQIE" XX CO join(AACY024077580.1:1..1039) // ID EP498467; SV 1; linear; genomic DNA; CON; ENV; 966 BP. XX AC EP498467; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549874 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-966 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-966 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-966 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-966 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c94840aa3ded1ff77b7868c8e338ae27. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..966 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..463 FT /locus_tag="GOS_263944" FT CDS <1..463 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263944" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701704606; CAM_CL_4871" FT /inference="protein motif:Pfam (release 17):PF03167.7" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00758" FT /protein_id="EBB25622.1" FT /translation="LIGESPGAEEEKLGVPFKGEVGELLNKMLIAINIKRQNIYTSYAI FT NFRPPDDRKPTSTEIKRYSVFLKEHISIINPKIIVLMGSSAMEAVTGISEKITTERGHW FT KEVILKNKTFPLMITFNPSYLIRFPENKKHSWEDLKKIRDKIKDLKLKI" FT gene 460..>966 FT /locus_tag="GOS_263946" FT CDS 460..>966 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263946" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701704604; CAM_CL_782" FT /inference="protein motif:Pfam (release 17):PF01351.7" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00729" FT /protein_id="EBB25623.1" FT /translation="MMKIIAGVDEVGRGSLIGPVYASAVILKKSINSKLLKDSKSLSKK FT EREYLCTYIKKNSTWSIGKASVKEIEKLNILQASLLAMKRAIKKLKRKPTHVLIDGNKT FT PELENYNLKSVIKGDKKIPSISAASIIAKVSRDKFITTLSKKNKGYDWDKNFGYGTKHH FT LKALKK" XX CO join(AACY024077581.1:1..966) // ID EP498468; SV 1; linear; genomic DNA; CON; ENV; 942 BP. XX AC EP498468; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549876 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-942 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-942 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-942 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-942 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 084cbbcdae356a3e1e0c86e6218951a1. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..942 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..364 FT /locus_tag="GOS_263948" FT CDS <1..364 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263948" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701676230; CAM_CL_8470" FT /protein_id="EBB25620.1" FT /translation="EDKISKKFFFIYWKAHGFSYGIPFKEIKKIKQGKKVIFNGSRKIL FT FKIKKKVNNVKIINITASSTIIKRRLVNRAREDKKSIIKRIKRKINLLPKNTITIINNK FT SISIGTNKLKKIILAE" FT gene complement(353..898) FT /locus_tag="GOS_263949" FT CDS complement(353..898) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263949" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701676228; CAM_CL_7585" FT /protein_id="EBB25621.1" FT /translation="MDNNILIAKKYGFHGTLIPPFKLNNNYNRKKLFKKIEVVAKKYKK FT FNFYKFKLKKIDNFYAFVQSKKNNNINKLSNRLVRELFKFRSPLTKKEIDRRNPSKLSK FT LQLSILYKWGYPYLMSEFNFHMTLASEVSGNKLYFELKKIEKNKEIILNETNDFDKIYI FT FGENQKGMFENLENFSLS" XX CO join(AACY024077582.1:1..942) // ID EP498469; SV 1; linear; genomic DNA; CON; ENV; 981 BP. XX AC EP498469; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549882 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-981 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-981 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-981 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-981 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e4b700e9c44de1ad4e47a6c000171af9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..981 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..511) FT /locus_tag="GOS_263950" FT CDS complement(<1..511) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263950" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701236348; CAM_CL_5043" FT /protein_id="EBB25618.1" FT /translation="MKNYILALTILLSSCSFEQANDDEVVIYTSRQPQLIENLLDVFTE FT ETGIQVTVLSGDAQQLMERIAVEGVDTDADIFMTVDAGVLWQAADKGIFDPVESEVLSS FT RIPQHLRDIDNQWFGFSKRARTIVYSKTDIDPQDLSSYEALATREFKGKLCLRTSKKVY FT NRSLIAS" FT gene complement(560..>981) FT /locus_tag="GOS_263951" FT CDS complement(560..>981) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263951" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701236350; CAM_CL_3198" FT /inference="protein motif:Pfam (release 17):PF01494.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01984" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01988" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01989" FT /protein_id="EBB25619.1" FT /translation="KIGNSFQMRSKVQSFNLSSHNRSSYIDFPVVLVGDSAHSIHPLAG FT QGINLGFEDANSLVKKIIKINDSDTINFKESLNAYSNERRLQNEIMLKTMDGFVALFNE FT RNPYIRFLRNFGLNAFNQSKFLKSFFVKAASGPIK" XX CO join(AACY024077583.1:1..981) // ID EP498470; SV 1; linear; genomic DNA; CON; ENV; 959 BP. XX AC EP498470; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549888 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-959 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-959 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-959 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-959 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8856ddfc1a645289010577708f99f727. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..959 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 155..901 FT /locus_tag="GOS_263955" FT CDS 155..901 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263955" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096700997220; CAM_CL_4645" FT /inference="protein motif:Pfam (release 17):PF03060.5" FT /protein_id="EBB25617.1" FT /translation="MNKLTNMLGCKYPIIQTAMGWVALPELVAASSNAGAFGFLALATA FT GPKEAIEMMDETQALTNKPFGINFHMFQPGAEEIVQAVIDKKIKAVSYSRSPTPEYIQA FT FKAAGVVCIPTVGALKHAVKAEQLGADAIVIQGSEGGGHTGSTPTTLLLSSVLESVNVP FT IVAAGGFRDGSGLAASLAWGACGIAMGTRFMMTKESPVPHDTKEAYLSANVEDIKITKK FT FDGMSHRLIFNNYIKKIDRSNPLAYL" XX CO join(AACY024077584.1:1..959) // ID EP498471; SV 1; linear; genomic DNA; CON; ENV; 1007 BP. XX AC EP498471; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549899 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1007 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1007 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1007 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1007 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 2f68bc7417309694e32974a72ed486a4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1007 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..346) FT /locus_tag="GOS_263958" FT CDS complement(<1..346) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263958" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701195818; CAM_CL_4670" FT /protein_id="EBB25616.1" FT /translation="MLHSFWRGCLRMFSDRVEAKWIDMFCKVFCLCKVEEGDTVAILSE FT SQSRTLNVSLAELALLRLGAKVFHVRLPTPPQASSIPIRSTGASNSVQGIGPVVMALRS FT SSIVVDCTVEG" FT gene complement(375..>1007) FT /locus_tag="GOS_263956" FT CDS complement(375..>1007) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263956" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701195816; CAM_CL_6378" FT /inference="protein motif:Pfam (release 17):PF00043.13" FT /inference="protein motif:Pfam (release 17):PF02798.8" FT /protein_id="EBB25615.1" FT /translation="DGDQFGSGFVGINPNSKIPALMDRSTSPGTRVFESGAILLYLAEK FT FQAFLPSAPENRAECLSWVFWQMGSAPYLGGGFGHFYAYAPDRWEYPINRFAMEVKRQL FT DVLDSHLAQNEYMCGSEYTIADMAIWPWYGALVLNRVYDAAEFLEAHSYERVMKWAKQI FT DGRKAVQRGRMVNRFTGKTKYQLRERHEASDFDNRTQDKIEAAGENE" XX CO join(AACY024077585.1:1..1007) // ID EP498472; SV 1; linear; genomic DNA; CON; ENV; 992 BP. XX AC EP498472; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549902 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-992 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-992 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-992 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-992 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0c7e87893a2fb713a9ba34cdb3575176. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..992 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(4..186) FT /locus_tag="GOS_263965" FT CDS complement(4..186) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263965" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701394938; CAM_CL_11783196" FT /protein_id="EBB25614.1" FT /translation="MAAFSDSKTIRGSFNLTLSPGFIFISIISVDSASPRFGIFNSIVL FT SSSMVPLYLKPYQNL" FT gene 41..952 FT /locus_tag="GOS_263959" FT CDS 41..952 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263959" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701394932; CAM_CL_1069" FT /inference="protein motif:Pfam (release 17):PF00198.11" FT /inference="protein motif:Pfam (release 17):PF00364.10" FT /inference="protein motif:Pfam (release 17):PF02817.5" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01347" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01348" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01349" FT /protein_id="EBB25613.1" FT /translation="MEELSTIELKIPNLGEAESTEIIEINIKPGDKVKLNDPLIVLESE FT KAAMEVPSDYDGEITEVLVKEGHSVSEGMLFAKIKAKTAISAKKEIDKPTPKTTSEPKQ FT PIKKEVIAVSGINAGPAVRKYARELEIDLTKINGTGKNQRITKEDLKNYIHSSKETSLD FT LKTYKESDFSEEGKYSLQKMSKIRVLGAKNVQAAWNSIPHVTHFDEINMSKINRAKEKN FT NANPLAFMIKALSETLKEFPIFNSSLIENDQIVLKKYINIGIAVDTKEGLVVPCIQDAD FT KLSLEEISAKVKELAEKARIKN" XX CO join(AACY024077586.1:1..992) // ID EP498473; SV 1; linear; genomic DNA; CON; ENV; 777 BP. XX AC EP498473; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549910 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-777 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-777 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-777 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-777 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 99691283faae308f49960cfe2c6b66fa. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..777 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077587.1:1..777) // ID EP498474; SV 1; linear; genomic DNA; CON; ENV; 963 BP. XX AC EP498474; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549918 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-963 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-963 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-963 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-963 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 526f4a7f68a2c1441954c1e7477d8ce8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..963 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 11..>963 FT /locus_tag="GOS_263966" FT CDS 11..>963 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263966" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701314692; CAM_CL_53" FT /inference="protein motif:Pfam (release 17):PF00135.15" FT /protein_id="EBB25612.1" FT /translation="MGSRNIGFFGGDSSNITIFGESAGGYNVAALLSAKQANGLFHKAI FT IQSGGIRPGDIEHSESYVEKNLPWKNYSSRELVNELLVMNEMASDRNSAASLQENLSQK FT EIEALMRNASTTEIYEAYLVTKTNTDDMLRPFPDGNVLSELGIMGSLESGFNSNVPIMI FT GTNRDEMKLFLLNNPRLTREFLRIPRIRDLDLWNAVSKHRSNSWKYLAVDEPAQSLTSS FT GRSNIYAYRFDWDDEPRKYGVDLKNLLGAAHAFEIPFVMGNFDEDALTRYILSRKNLEE FT VKTLSQSMMSYWAEFAHNGDPDKGREGNLTDWQAWDP" XX CO join(AACY024077588.1:1..963) // ID EP498475; SV 1; linear; genomic DNA; CON; ENV; 868 BP. XX AC EP498475; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549921 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-868 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-868 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-868 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-868 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; af8a0966eecfe9e3195b68b35b74b5a6. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..868 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>866 FT /locus_tag="GOS_263967" FT CDS <1..>866 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263967" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701615882; CAM_CL_2734" FT /inference="protein motif:Pfam (release 17):PF03030.5" FT /protein_id="EBB25611.1" FT /translation="FAMGASVVALFSRVGGGIFTKSADVGADLVGKIEAGIPEDDPRNP FT GVIADNVGDNVGDVAGMGSDIFESYCGSMIASIAIAYTLGNQDMMMLPLALAATGLIAS FT IIGIFIVKLQSAKAPASALRSGTLLAPVIFVAMAYFIIDSFDDVGMNVWWCVIAGAVGG FT VLIGLITEFYTGGSPVRKIAESGETGSATVMISGLSVGMQSVVIPIVILALIILVSTYL FT SDIYGVGIAAVGMLATVGITMAIDAYGPVADNAGGIAEMSGMGEEVREITDSLDELGNT FT TAAIGKG" XX CO join(AACY024077589.1:1..868) // ID EP498476; SV 1; linear; genomic DNA; CON; ENV; 852 BP. XX AC EP498476; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549925 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-852 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-852 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-852 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-852 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8509beff5c158b9bca352248530408f5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..852 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..348) FT /locus_tag="GOS_263968" FT CDS complement(<1..348) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263968" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701686228; CAM_CL_13173076" FT /protein_id="EBB25609.1" FT /translation="MIFLNLLESKFMEPFSFINPSIEVLGVLIQEPITTLTDFIVTIIS FT LYAFYRIRKHPFKNRVLTFFKWYFLLMGIATFSGGIFGHAFLYYFNEYWKIPGWYISMI FT AIMLVERSAIIY" FT gene complement(516..770) FT /locus_tag="GOS_263969" FT CDS complement(516..770) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263969" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096701686230; CAM_CL_13203063" FT /protein_id="EBB25610.1" FT /translation="MYPNNTAGEGIITMKISDSAGTTEFVTWHGVAGSVGIINNFFNNK FT DKIKRIYNLNGQIINNFIPNTINIVELQNGVIYKTFISN" XX CO join(AACY024077590.1:1..852) // ID EP498477; SV 1; linear; genomic DNA; CON; ENV; 910 BP. XX AC EP498477; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549928 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-910 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-910 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-910 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-910 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 49654c7f9fcf1a6ef28640fff2e6b220. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..910 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>909 FT /locus_tag="GOS_263970" FT CDS <1..>909 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263970" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685004624; CAM_CL_3203" FT /inference="protein motif:Pfam (release 17):PF03901.6" FT /protein_id="EBB25608.1" FT /translation="PSRASSVVRTTTSDTSGNMLLSAMTDSSNDAPMTNFFDVRSRARR FT RLRALARPGVELAGDALADFGARSRAGSHSVECESRNAHLDVRGRRARDGRATRMKNMF FT HRALGIILASRAIVCATNFTTFDCDEAFNFWEPLHYLTHGHGLQTWEHGGEFALRSYAY FT LAMHYPVAMVGRALFGADDGRSTFALVRAALGAASAYCEADLVDAVSGRSAITGAILMV FT IFATNTGMAIASTAFLPSSFAMMCVAVATAAALRREHRRACKACVMAVVFGWPFSGIAT FT IPFGLYAIYGVGFSATMRTVWR" XX CO join(AACY024077591.1:1..910) // ID EP498478; SV 1; linear; genomic DNA; CON; ENV; 919 BP. XX AC EP498478; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549940 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-919 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-919 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-919 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-919 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 758552791d53ecf8c7f2036f81ba396e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..919 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..534) FT /locus_tag="GOS_263971" FT CDS complement(<1..534) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263971" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684964920; CAM_CL_920" FT /inference="protein motif:Pfam (release 17):PF07715.2" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01783" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01785" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01786" FT /protein_id="EBB25606.1" FT /translation="MMDNFKRIAFAFLATAVFTSFNDATAQEVEVEEVVVTATRREESL FT QDVALSAQALTSDDLDAQQVTEMYDLGELTPGITFSPAIGSGYFIGIRGSATEAIGASS FT VGSVQTAVNGHVINSGAFADMGFLDAERIEILAGPQGTLYGRNVTGGLINVISAKTYLV FT TLLDMQKCNMVTLVK" FT gene 614..>919 FT /locus_tag="GOS_263975" FT CDS 614..>919 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263975" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684964922; CAM_CL_7051" FT /inference="protein motif:Pfam (release 17):PF00881.12" FT /protein_id="EBB25607.1" FT /translation="MILRLLFTLKILLIKEKMNILDAIQARQSIRSFKNKEVSKEIIEN FT ILNISKFAPSGGNTQPWKIYVLSQDLMKKLETSVLSNLDNGVSETPNFNIYPQPMSD" XX CO join(AACY024077592.1:1..919) // ID EP498479; SV 1; linear; genomic DNA; CON; ENV; 937 BP. XX AC EP498479; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549962 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-937 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-937 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-937 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-937 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 73ee408dfb7aae8ba8b9a456a75dc925. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..937 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..770) FT /locus_tag="GOS_263976" FT CDS complement(<1..770) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263976" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684707486; CAM_CL_1408" FT /inference="protein motif:Pfam (release 17):PF00749.9" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00463" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00464" FT /protein_id="EBB25605.1" FT /translation="MTKKNRLRFAPSPTGPLHIGGLRTALFNYLFAKKTDGELVLRVED FT TDQARKVEKSQEHIENSLAWIGIDFDESSKKGGQFGPYNQSERKDIYKKHVNVLIEKGW FT AYYAFDKKEKLDFHRLDHEKKGKKFIYNAHNRLKLDNSLSMDKKDVEERIQKENYVVRF FT KTPSETNVVFNDIIRGEILVGTRDIDDKILFKSDGMPTYHLANVVDDHLMEITHVIRGE FT EWLPSLALHVLLYRAFDWQEPKFAHLPLILKPTG" XX CO join(AACY024077593.1:1..937) // ID EP498480; SV 1; linear; genomic DNA; CON; ENV; 1069 BP. XX AC EP498480; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549964 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1069 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1069 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1069 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1069 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f377ed3925c39d6183b577bf0a5c4809. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1069 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..756 FT /locus_tag="GOS_263979" FT CDS <1..756 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263979" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685255088; CAM_CL_3658" FT /inference="protein motif:Pfam (release 17):PF00670.10" FT /inference="protein motif:Pfam (release 17):PF05221.5" FT /protein_id="EBB25603.1" FT /translation="SVTKSKFDNKYGCKESAVDAIRRATDIMIAGKRVVVCGYGDVGKG FT TAASFRGAGAIVTITEIDPICALQASMDGYEVKKLNTVIKNADIVITATGNKDIVTEEH FT FKVMKDKTIVCNIGHFDNEIDMDWLNSNYGDKRSNIKPQVDIYTLDNNSQVIILAEGRL FT VNLGCATGHPSFVMSNSFTNQVLAQIELWKNSKQYENKVYVLPKNLDEMVALLHLPKLG FT VELENLTEEQAKYIGVNKSGPYKPEYYRY" FT gene complement(753..1016) FT /locus_tag="GOS_263981" FT CDS complement(753..1016) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263981" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685255092; CAM_CL_14605" FT /inference="protein motif:Pfam (release 17):PF01016.8" FT /protein_id="EBB25604.1" FT /translation="MMAHKKGVGSSKNGRESESKRLGVKIFGGQLAKAGNIIVRQRGTK FT HRPGENVYIGKDHTLHAKVDGTVSFRKKSNDKSYVSIIPNEG" XX CO join(AACY024077594.1:1..1069) // ID EP498481; SV 1; linear; genomic DNA; CON; ENV; 976 BP. XX AC EP498481; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549970 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-976 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-976 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-976 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-976 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c63077595e518d0fdd720a5100c79937. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..976 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..339) FT /locus_tag="GOS_263982" FT CDS complement(<1..339) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263982" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685048402; CAM_CL_4747" FT /inference="protein motif:Pfam (release 17):PF03453.6" FT /protein_id="EBB25601.1" FT /translation="MNTYKFALKHLIKNKISIKDEKISINLSLNRISSSDIISSVNYPS FT CDNTAFDGYAISSKETNSLNLKNPKKFKIIKTLAAGDNPYIRKIPKYSAIEVMTGAIVQ FT KPFDTIIPV" FT gene complement(336..953) FT /locus_tag="GOS_263983" FT CDS complement(336..953) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263983" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685048400; CAM_CL_8663" FT /protein_id="EBB25602.1" FT /translation="MFNLMSENNILGVVLAGGRSKRFGNDKTVAKLGNKTLLDHTIEKI FT EKNFHEILIVSNNEKLDINKKNIFSTKDLIEGYLGPLVGVLTAMVWIEKNKKNYNWIAT FT FPCDTPFFDENLINKIKNFPKKSEKKLFFLKSGSRRHNIFGLWSLELKETLLEDINNGH FT RKVEEWANKVGPEIIEIDDKNEYNFLNINTKEDLEKAKNKIK" XX CO join(AACY024077595.1:1..976) // ID EP498482; SV 1; linear; genomic DNA; CON; ENV; 955 BP. XX AC EP498482; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549972 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-955 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-955 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-955 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-955 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c6cce77d90dfa22222d512e2d7dc1637. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..955 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 21..>955 FT /locus_tag="GOS_263984" FT CDS 21..>955 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263984" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685174836; CAM_CL_1511" FT /inference="protein motif:Pfam (release 17):PF00575.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00757" FT /protein_id="EBB25600.1" FT /translation="MVLTISLTKGVSMKRILINSSYNDELRVALVDGAKLFDLDTEVTD FT RVLYKGSIFKATVSRIEQSLNAAFVDFGSTRHGFLPLRELSKNFYKKNSQGKSECTLKE FT GQEILVQINKEERGTKGATLSTQISIAGRFMVLIANSDKSGGISRRITGDEREDLKNQI FT SKLDIPEGMSVIIRTAGIERSFEELQNDLNYLISLWDDINATQASADSPQLIYKDDKLI FT VRVFRDIFRDDIEEILVDDKSLFEEAKNFAELVIPDQKDKVKLYDEEIPLFNRYQIESQ FT IELAFQREISLPSGGSIVIDPTEAMTTIDI" XX CO join(AACY024077596.1:1..955) // ID EP498483; SV 1; linear; genomic DNA; CON; ENV; 960 BP. XX AC EP498483; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549974 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-960 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-960 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-960 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-960 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 7a4854313844d997acd7f03b1a7da111. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..960 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..225) FT /locus_tag="GOS_263987" FT CDS complement(<1..225) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263987" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685116882; CAM_CL_3691" FT /inference="protein motif:Pfam (release 17):PF02746.5" FT /protein_id="EBB25599.1" FT /translation="MSILHISLRGSKDMKIESINTYVVDAGWRPWQFTEIKTDSGITGY FT GEMSDGRNPWGIVGTVEDFKPLLIGKDPLN" FT gene 101..>960 FT /locus_tag="GOS_263986" FT CDS 101..>960 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263986" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685116878; CAM_CL_3819" FT /inference="protein motif:Pfam (release 17):PF03781.5" FT /protein_id="EBB25598.1" FT /translation="MPESVLISVNCQGLHPASTTYVFIDSIFMSLLPLSDICNIDINQF FT KVNIKKEINNMSEKNCCSPKSERPELIKFNESLSKNNISDFKNMKLIESGKFLMGTSYD FT LGFLSDGEGPVREIEIDEFYMDKFPVTNLEFERFCSSTNYKTEAESYGWSFVFYQLVSE FT KTKNEVKESVSNAPWWWKIDGANWRNPYGNDSSLDGLENHPVVHVSWNDANAYSNWIGK FT DLPTEAEWEYAARGGLEQKLYAWGDDGSELFNKCNIWDGNFPNENTLDDGWLGTSPVDF FT FKPNN" XX CO join(AACY024077597.1:1..960) // ID EP498484; SV 1; linear; genomic DNA; CON; ENV; 1323 BP. XX AC EP498484; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549977 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1323 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1323 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1323 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1323 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 99bc408c500e8a24a6207017b5d2bd6c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1323 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 321..929 FT /locus_tag="GOS_263988" FT CDS 321..929 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263988" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684927926; CAM_CL_387" FT /inference="protein motif:Pfam (release 17):PF04367.2" FT /protein_id="EBB25596.1" FT /translation="MKKKRSLTLILRNYFITGVVVLIPIGFTLYLSKILIGLSSKIIPE FT NINPNNYLPYAIPGIEILISIIFITIVGGLSLSFLGKRILRLIDDLFKRIPFLRTIYSA FT ILQMTETFSKKDNDKKSVVLIEYPRKGVWAVGFATKENKGEMAQKTNQKLINVFVPTTP FT NPTSGFLLMFPIDDVIYLNMTFEEASKFIVSAGTSTGKN" FT gene complement(926..>1323) FT /locus_tag="GOS_263989" FT CDS complement(926..>1323) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263989" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684927928; CAM_CL_1469" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00580" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00643" FT /protein_id="EBB25597.1" FT /translation="IIIENANKFGLSQLHQLRGRVGRGTKESTCILMFKSNLSDNAKKR FT INILKNSNDGFKISEEDMKLRGFGDILGFKQSGIKNFKLADPIHNIDLFLLAEKEIKRI FT ENSNEDISKFKPLVKLYDRADIINDIA" XX CO join(AACY024077598.1:1..1323) // ID EP498485; SV 1; linear; genomic DNA; CON; ENV; 956 BP. XX AC EP498485; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549979 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-956 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-956 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-956 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-956 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 3c6aef720ed61e46fe5da4725f9c2230. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..956 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077599.1:1..956) // ID EP498486; SV 1; linear; genomic DNA; CON; ENV; 827 BP. XX AC EP498486; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549981 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-827 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-827 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-827 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-827 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 044d986e9c50eaa2257619113b7575b8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..827 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..467 FT /locus_tag="GOS_263991" FT CDS <1..467 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_263991" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685035462; CAM_CL_7668" FT /protein_id="EBB25594.1" FT /translation="WNIKPIKFKIMFNLFKKEDSDKNNNLSLIAVASILIHSAKIDENF FT TEKEKEIIKKALIEMGAQPEKIDEIMEESEKKEKDSNQILDFTREIKSINEDKKKLIIE FT ALWNIIYSDQNADMYETNLMRRLSGLLYLDNGVVGDIKQKIIKKNNDISS" FT gene 448..780 FT /locus_tag="GOS_263992" FT CDS 448..780 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263992" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685035464; CAM_CL_7188" FT /inference="protein motif:Pfam (release 17):PF00037.13" FT /protein_id="EBB25595.1" FT /translation="MMTYLVNDKCIKCKLTDCVEVCPVDCFYEGKNMLVIKPDECIDCG FT VCEPECPVDAIVSDTEDGSNKWLEVNTKYSEIWPNISKKKDPPADHEQFKDVKDKYEKY FT FKENLE" XX CO join(AACY024077600.1:1..827) // ID EP498487; SV 1; linear; genomic DNA; CON; ENV; 1042 BP. XX AC EP498487; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549984 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1042 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1042 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1042 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1042 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c1cd5cfac0ac8511d0c0be4b82000683. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1042 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..970 FT /locus_tag="GOS_263993" FT CDS <1..970 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263993" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684905932; CAM_CL_1528" FT /inference="protein motif:Pfam (release 17):PF00815.9" FT /protein_id="EBB25593.1" FT /translation="AGQKLIPVNTAGCYVPAGRYAHIASAVMSVTTAKVAGVKNIIVCS FT SPKPGVGVHPAIVYTADLCGADVIMNLGGVQAIAAMTYGLFGNAPADMLVGPGNQFVAE FT SKRILFGKVGIDLFAGPTEIAVIADETADPELVAFDLVGQAEHGYNSPAWLFTTSKSLA FT EYVMKRVPELIADLPDLPRENSGAAWRDYGEVILCDTDEEMAKISDEYAPEHLEIQTKN FT LQWFHDRLKNYGSLFIGEETTVAYGDKCSGTNHILPTKGAGKYTGGLFVGKFIKTLSFQ FT RMTKESTKEVGAACARISRYEGMEAHARTGDVRLRKYGFSN" XX CO join(AACY024077601.1:1..1042) // ID EP498488; SV 1; linear; genomic DNA; CON; ENV; 1338 BP. XX AC EP498488; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549987 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1338 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1338 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1338 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1338 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; cc6f656761eb4cf94df4b33d51a88ffc. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1338 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..949 FT /locus_tag="GOS_263994" FT CDS <1..949 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_263994" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684738336; CAM_CL_4846" FT /inference="protein motif:Pfam (release 17):PF00472.8" FT /inference="protein motif:Pfam (release 17):PF03462.6" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00019" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00020" FT /protein_id="EBB25591.1" FT /translation="EKSTDLNKRKTFLEKSLATYKDSLNKLSDNKLLLDMALEEDDQTT FT IKQISDEILEIKPSIENLEFTKMFSGKMDSSNAFVDIQSGSGGTEAQDWADMLLRMYLK FT WAESKGFSATITESSPGEVAGIKSSSILIEGDYAYGWLRSETGVHRLVRKSPFDSGNRR FT HTSFASVFISPEINDDIEIEINNADIRVDTYRASGAGGQHVNKTDSAVRLTHIPTGTVS FT QCQNGRSQHKNKENALKQLKSKLYELELQKQKEEQQKLEDSKADIGWGSQIRSYVLDQS FT RIKDLRTNYETGNTSAVLDGNIDEFMRASLKAGI" FT gene 950..>1338 FT /locus_tag="GOS_263998" FT CDS 950..>1338 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_263998" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684738338; CAM_CL_1394" FT /inference="protein motif:Pfam (release 17):PF01336.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00499" FT /protein_id="EBB25592.1" FT /translation="MSEDKKGGEKAILEERRKKLENLRDKGVAYANSFRPKNSANEIHK FT LYGETSKDDLAEKNIKNISIAGRIVLKRVMGNASFATLRDASGDIQIYVTKNNIDESAY FT DDFKTWDLGDIVGVSGSLFRTKTDEL" XX CO join(AACY024077602.1:1..1338) // ID EP498489; SV 1; linear; genomic DNA; CON; ENV; 915 BP. XX AC EP498489; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549993 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-915 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-915 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-915 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-915 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 058a6d4702aa330ea4dc820daa6c78bd. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..915 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..236) FT /locus_tag="GOS_264002" FT CDS complement(<1..236) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264002" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684766354; CAM_CL_1324" FT /inference="protein motif:Pfam (release 17):PF00528.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00974" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02138" FT /protein_id="EBB25590.1" FT /translation="MLSRASLKAVPPSIREAALAMGASRMQTTMHHTVPLSMPGTLSGT FT IIGLAQALGETAPLILIGMVAFVNTIPGSPMDPA" FT gene complement(226..>915) FT /locus_tag="GOS_264000" FT CDS complement(226..>915) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264000" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684766352; CAM_CL_1324" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00974" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02138" FT /protein_id="EBB25589.1" FT /translation="YLDANPSKEDLEDADYFEISLQSMFNLDKNANEKQQNELKKMVSY FT FFEREIKQELINDPSLLGKTKDVYITASDDLDQVFKGNYPRDLPENQRRVTDYQLKIFD FT QLVEQGKVESKFNLSFFTYPDSREAELAGIASSFMGSIFSILVCLAIAFPVAVLAAIYL FT EEFAPKNRFTDFIEVNINNLAAVPSIVFGLLGLGILLAVFQLPRSTPLVGGITLSLMTL FT PTIIIAF" XX CO join(AACY024077603.1:1..915) // ID EP498490; SV 1; linear; genomic DNA; CON; ENV; 972 BP. XX AC EP498490; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549997 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-972 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-972 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-972 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-972 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f865b24851a3fe840e3dd76db5f01703. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..972 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..321) FT /locus_tag="GOS_264006" FT CDS complement(<1..321) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264006" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685055362; CAM_CL_8129" FT /protein_id="EBB25587.1" FT /translation="MVTTGINPSLSNLGDSNFPSSISSIFSLFLNIMVAVSTILLDILN FT ISNYIKKPYISGVMKLVKEINKENLNNKISDKEAEEAFVKILKWLGEDPDREGLLETPK FT RVV" FT gene 185..694 FT /locus_tag="GOS_264005" FT CDS 185..694 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264005" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685055358; CAM_CL_9688" FT /inference="protein motif:Pfam (release 17):PF01502.7" FT /protein_id="EBB25586.1" FT /translation="MFNISNNMVLTATIMFKKRENIEEIEEGKLLSPKFDNDGLIPVVT FT TCYNTKEILMHGYMNVEALKLSIETKEAHYWSRSRKQIWHKGKTSGFVQKIKEIRIDDD FT QDSVWMSVDIGDGASCHVGYKSCFYRSIPLGKISNARQIEMKFEEKEKKFNPEEVYKGQ FT PNPTKI" FT gene 624..>972 FT /locus_tag="GOS_264007" FT CDS 624..>972 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264007" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685055360; CAM_CL_7936" FT /protein_id="EBB25588.1" FT /translation="MKKKKKNLIQKKFIKDNLIQQKYKMSSEKNKIQIFRPFGPSVAKI FT IMSEEIIKLLNDYVDKIVDDKKKSKELDYGDQLAGNVIQEFKLEEEFMKTSGWAKFLAN FT STSKWLENTEKK" XX CO join(AACY024077604.1:1..972) // ID EP498491; SV 1; linear; genomic DNA; CON; ENV; 898 BP. XX AC EP498491; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626549999 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-898 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-898 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-898 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-898 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f176df5e429d8a7a207d9108e07a071c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..898 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(18..602) FT /locus_tag="GOS_264008" FT CDS complement(18..602) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264008" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685124156; CAM_CL_1374" FT /inference="protein motif:Pfam (release 17):PF00528.10" FT /protein_id="EBB25584.1" FT /translation="MKITLDFHNYKADYNMRKINFWYISSFLISFVVLIPIATVSFSFF FT EETSNYYQILKETFLIEYIFNSVSLLVGVLLLTFIFGTGSAYLVSFYNFPGSNFFKWAL FT ILSFAVPPYIYAYSLFAFFDNYGTAYSILKNLFGDGNYNKIIPKFDGMIGAILSLSFSL FT FAYVYILARASFLYQSQNLIDLRKNLGFSKK" FT gene complement(639..872) FT /locus_tag="GOS_264009" FT CDS complement(639..872) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264009" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685124158; CAM_CL_17488" FT /protein_id="EBB25585.1" FT /translation="MWKKSSCCSRGNDGCWLEINMVEQKKEFITEVDYNKSSVACPTCS FT TECKKINDRINGRDLSKIKPKEVLHILKVFNF" XX CO join(AACY024077605.1:1..898) // ID EP498492; SV 1; linear; genomic DNA; CON; ENV; 792 BP. XX AC EP498492; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550006 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-792 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-792 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-792 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-792 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6a2c9fcacd2f62b4155c1b2bea1b4c32. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..792 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>791 FT /locus_tag="GOS_264010" FT CDS <1..>791 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264010" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684755072; CAM_CL_718" FT /protein_id="EBB25583.1" FT /translation="NCTRRNFLIGGSTTLFLSGYFPKISFASMQKKNLIIISLRGGMDG FT LTAIPVIGDKSLKKLRKKLILEDVLKLNSDFGLHPKLEIFHKLWEINQAAFVHATNIPY FT TGRSHFDGQNLMETGAHIPYKEKTGWLGRGLLASNIIGKGLAISLPMPLLLRGVPQNNN FT FFPSPDFVETKLIDQIYNEFKGEHNELIKSTLDTIKQRPFSMQIATDSEDRKKLALEAA FT KQLKDQSGPRVAVFDLDGFDTHTAQGGVDGAHADELEEVNK" XX CO join(AACY024077606.1:1..792) // ID EP498493; SV 1; linear; genomic DNA; CON; ENV; 942 BP. XX AC EP498493; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550011 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-942 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-942 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-942 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-942 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 302b19b6cc7b14ddfea732b38e7e616e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..942 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>941 FT /locus_tag="GOS_264011" FT CDS <1..>941 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264011" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685104756; CAM_CL_3741" FT /protein_id="EBB25582.1" FT /translation="CFIHASVNVAILANKAATARDLLGRLQLAYEHMPKWLQQGVMSWN FT KGSLELENGSKILASSTSASAVRGGSYNIIFLDEFAYVPSNVAEQFFSSVYPTISSGKT FT TKVMIVSTPHGMNMFYKLWVDAEEQRNEYIPIEVHWSEVPGRDEEWKQQTIKNTSEAQF FT NTEFECEFLGSIDTLISPRILRQLTYREPNQSHASLDIHHHPEENHTYMVCCDVSRGTS FT NDYSAFIVFDITEMPYKISAKFRDNELKPHLFPSKIYDIARAYNQAFVLIEINDIGEQV FT ASAMQFDLEYDNLVMASMRGRSGQVMGGGFSG" XX CO join(AACY024077607.1:1..942) // ID EP498494; SV 1; linear; genomic DNA; CON; ENV; 988 BP. XX AC EP498494; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550013 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-988 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-988 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-988 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-988 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8b3912709c61322048a987f1d03de093. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..988 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..775) FT /locus_tag="GOS_264012" FT CDS complement(<1..775) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264012" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684975542; CAM_CL_4294" FT /protein_id="EBB25580.1" FT /translation="MIKRLLIFGCGYSCSRLGKILNQSGWEVFGTVRSYKKAIEIEKFG FT IKSVFFEDEEKLKAIMADEISILVSIPPSSDGDVVLERFASSIDFLFRNVNWLGYFSTT FT GVYGNYDGEWVNEDSQLKASFGLGKNRILAEKKWNEISRNMEIPLYIFRLSGIYGPCRS FT VIERLRSGVAKKIIKKDHYFNRIHVDDISGVVIKSLNFPDLAGIYNVSDDFPCPGYEVV FT EEAARLLGISPVEEVDFEDANLSEMAKKFYCDSKRI" FT gene complement(768..>988) FT /locus_tag="GOS_264013" FT CDS complement(768..>988) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264013" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684975544; CAM_CL_4958" FT /protein_id="EBB25581.1" FT /translation="ASLNDKEFRAMFAKSPVKRIGRDRFVRNVAYAMGNSKKTRFLPIL FT DTLMKDADFSVRDAAQWAILNLKKIND" XX CO join(AACY024077608.1:1..988) // ID EP498495; SV 1; linear; genomic DNA; CON; ENV; 1038 BP. XX AC EP498495; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550018 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1038 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1038 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1038 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1038 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; fb502a4439de41f83ece171b447b5435. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1038 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..608 FT /locus_tag="GOS_264014" FT CDS <1..608 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264014" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684914964; CAM_CL_49" FT /inference="protein motif:Pfam (release 17):PF00106.13" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01829" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01830" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01831" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01832" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01963" FT /protein_id="EBB25578.1" FT /translation="TKKINSDKVSYQIGDVGNYENIEKNLADIEKTHKKIDIFINNAGV FT AGKNTTVVDYPLDEWKKVIDLNLNAVFYCCKAVTPYMLKNNYGRIVNIASIAGKEGNPN FT ASAYSTSKAGVIGLTKSLGKELALKNIAVNCVTPAAAKTRIFDQMTEEHINYMLSKIPR FT NKFAKVDELASLVTWLSSEENSFSTAAVFDLSGGRATY" FT gene 612..1028 FT /locus_tag="GOS_264020" FT CDS 612..1028 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264020" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684914966; CAM_CL_1548" FT /inference="protein motif:Pfam (release 17):PF00480.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00744" FT /protein_id="EBB25579.1" FT /translation="MQIGIDVGATKIESVVLDEKGNESNRERTDCPKDYSQIVKTIKEI FT NKKLEKKFNKELPIGVCHPGVHSPQTGLVKNAPNCYWLEKKPFQNDLRKELGKEVFCEN FT DANCFALSEALDGSGKHYKIVYGIIVGSGVGGGL" XX CO join(AACY024077609.1:1..1038) // ID EP498496; SV 1; linear; genomic DNA; CON; ENV; 912 BP. XX AC EP498496; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550025 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-912 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-912 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-912 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-912 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; d02fb1b4ec7ede7db7d875e404d23032. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..912 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..767 FT /locus_tag="GOS_264022" FT CDS <1..767 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264022" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684696914; CAM_CL_3916" FT /inference="protein motif:Pfam (release 17):PF00254.15" FT /inference="protein motif:Pfam (release 17):PF05698.3" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00115" FT /protein_id="EBB25577.1" FT /translation="NDFPVELGSKSMIEGFEDGLIGLKKGQEKTLQLKFPDDYGKSDLA FT SKPVSFDIEVIEISKAVLPELDEEFFKATGIEAKDIEDYKKQVLSKLEDDLENILQVKI FT RQNLYDALVEANEFDVPKAMVDSEISNMKLDTARRMGMDPKDLKEDLFPNETFEEEALK FT RVKIGMLLNAIIEDNEFKADPDKVKQIIEDRAKNYKEPQQVINYFYSDEEQLKNIESIS FT LEEQVVDLLISSAKSTDEELTYEECISGNYQG" XX CO join(AACY024077610.1:1..912) // ID EP498497; SV 1; linear; genomic DNA; CON; ENV; 941 BP. XX AC EP498497; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550034 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-941 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-941 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-941 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-941 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 61490446372e3f2fb29c822f15fea565. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..941 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..454) FT /locus_tag="GOS_264025" FT CDS complement(<1..454) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264025" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685145032; CAM_CL_11037562" FT /protein_id="EBB25575.1" FT /translation="MKYSRIVLQLIVLISLFTACRKQWSATEQDMANYGWNLYEQGDYV FT TSYEWFSNSIIEDNNYQDGYNGLGWTFGKLVELDSAVQTFAIGLSKPPNERITTNVSQE FT ILAGLAFAHSALKQDSSVILYGDSLIWLINQQIGEKTWSFSHDSTTN" FT gene complement(451..>941) FT /locus_tag="GOS_264026" FT CDS complement(451..>941) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264026" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685145030; CAM_CL_14477459" FT /protein_id="EBB25576.1" FT /translation="GDELREFNDPVKVSLMSYQEDQAIYQRNNDDSWTELPSYYNQGRI FT VAYTGKMGYFRLGRKTLVVPGLTSLGQNYPNPFNPVTKISYDVGFIDGPQQHVNLSIYN FT LLGQHVQTLVDTEQTIGRHTVQWYGRDKTGMNVASGVYFMHMTTSSGKIQTKKVMLLR" XX CO join(AACY024077611.1:1..941) // ID EP498498; SV 1; linear; genomic DNA; CON; ENV; 828 BP. XX AC EP498498; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550038 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-828 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-828 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-828 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-828 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c136a0bbe0efa60ad405de1e6c78a620. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..828 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..397) FT /locus_tag="GOS_264027" FT CDS complement(<1..397) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264027" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684995324; CAM_CL_10599" FT /protein_id="EBB25573.1" FT /translation="MFNISIFKYEKLHNILCLILICLLPLSLLSGSLIINLFCILITVI FT FLFESFKTKNFIFLKSKDFFILSLFWFFLILNTLLSTNFENSVGRGLGFFRFIILIFAL FT RYYFTIENNKYLKFIFNVWLLIFLVVTL" FT gene 463..>828 FT /locus_tag="GOS_264028" FT CDS 463..>828 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264028" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684995326; CAM_CL_1770" FT /protein_id="EBB25574.1" FT /translation="MIFLIYMTDSIINLTIILLFLSLITFSFIGYGVLFVKIFYLEKNN FT SFSVSHYSIFGMLFLVFVSYYSNLFLSHNEIFNSLLILIGIFNYIFFFKIKKKKESTIT FT ILFLIIIYFSFFLISKNH" XX CO join(AACY024077612.1:1..828) // ID EP498499; SV 1; linear; genomic DNA; CON; ENV; 978 BP. XX AC EP498499; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550051 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-978 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-978 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-978 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-978 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a226da8f5f4f414a04c6a6eda87f199b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..978 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..267 FT /locus_tag="GOS_264029" FT CDS <1..267 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264029" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684957362; CAM_CL_6585" FT /inference="protein motif:Pfam (release 17):PF01790.8" FT /protein_id="EBB25571.1" FT /translation="SSMRQCWEGLILFMILWIYSSEKRRRGMVAAAFLFYYGLFRIFIE FT FFRIPDSHIGYLYSDWLTLGQLLSLPMLILGLWIIITHRLKED" FT gene 293..>978 FT /locus_tag="GOS_264030" FT CDS 293..>978 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264030" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684957360; CAM_CL_1164" FT /inference="protein motif:Pfam (release 17):PF00303.7" FT /protein_id="EBB25572.1" FT /translation="MEQYLDLLQKILDEGEVKDDRTGTGTRSLFGHQMRFDLNQGFPIL FT TTKKIFFKGVVYELLWFLDGSTDNTLLKENGVHIWDEWETDKGDLGPIYGFQWRNWVDH FT NNGQPIDQIEQVIEQIRSNPSSRRIIVNAWNVADLPDESISPQENVKLGKMTLAPCHAL FT FQFFVSQGKLSCQLYQRSCDTFLGLGFNIASYSLLTHMIAQQCDLDVGDFIWTGGDVHL FT YLHHLE" XX CO join(AACY024077613.1:1..978) // ID EP498500; SV 1; linear; genomic DNA; CON; ENV; 885 BP. XX AC EP498500; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550053 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-885 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-885 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-885 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-885 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 878ad6beb3c26924b3d99c992fd4e573. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..885 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 143..853 FT /locus_tag="GOS_264031" FT CDS 143..853 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264031" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686324442; CAM_CL_1473" FT /inference="protein motif:Pfam (release 17):PF00189.9" FT /inference="protein motif:Pfam (release 17):PF00417.8" FT /inference="protein motif:Pfam (release 17):PF07650.4" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01008" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01009" FT /protein_id="EBB25570.1" FT /translation="MMGQKTNPIGNRLGIIRGWDSNWYGGKKYAEKIHEDSKIRDYIRA FT RLAKASVSKIVIERTLKLISITIHTARPGIIIGKGGQEVDKLKEEIKKLTGKDVQINIY FT EIKRPELDAKLVADSICRQIEGRISFRRAMKMAVASTMRMGAEGIKIQVAGRLNGAEMA FT RTESKKDGRIPLHTFRADVDYCWSEAHTTYGRLGVKVWICKGEVYGKVDLTPNNAPNNK FT QAGKGGKFKGKKRR" XX CO join(AACY024077614.1:1..885) // ID EP498501; SV 1; linear; genomic DNA; CON; ENV; 964 BP. XX AC EP498501; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550055 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-964 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-964 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-964 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-964 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; d3a7067e82993983de1c4053f72dd677. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..964 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..347) FT /locus_tag="GOS_264037" FT CDS complement(<1..347) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264037" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685326548; CAM_CL_12908" FT /protein_id="EBB25569.1" FT /translation="MMSLLDKSDEEIIKIAEPIWANLVKSSNIKDYGGFTKDFSSQMLY FT GANEVELGKQWASNELISSLSDGCKPFGCLKRGQYVTILYKQTSTKIPGEFLGRLVLGE FT EGGQVKVFGAT" FT gene complement(350..>964) FT /locus_tag="GOS_264036" FT CDS complement(350..>964) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264036" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685326546; CAM_CL_1312" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02061" FT /protein_id="EBB25568.1" FT /translation="HKFSSGSFTEGRLAAKAAVKYMKEEKAKDIKVSDKQCNEFKDIIF FT KPLENYTVGRNEITGGTVSPSYISPIQGLQRLQKIMDEYVGGISYNYMTNENTLKRGLE FT LLEWLQEDLENVGAEDYHQLMRAWELKHRTLTSQCVTEHTLFREETRWPGYYYRGDYMK FT LDDENWHCLTLSRRDPKTGKFSMEKAPVYHIVDEKEKKEAS" XX CO join(AACY024077615.1:1..964) // ID EP498502; SV 1; linear; genomic DNA; CON; ENV; 820 BP. XX AC EP498502; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550058 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-820 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-820 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-820 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-820 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; bb776935525082bc570b051c5ff49748. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..820 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..509) FT /locus_tag="GOS_264038" FT CDS complement(<1..509) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264038" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685164156; CAM_CL_1181" FT /inference="protein motif:Pfam (release 17):PF00347.11" FT /protein_id="EBB25566.1" FT /translation="MSRIGNAPVALPQGVEVSFNKGEVSVKGKLGELKQEISEGISIEV FT TENEVLLSRENETKDLKAKHGLYRSIVNNMVVGVSEGFTIKQELIGVGFRAKVTGQVLE FT MNLGFSHNVVFSLPEEVKVTAEQSKGQPPIVTFTSVDKQLVGQVAAKLRSLRKPEPYKG FT KGIKYVG" FT gene complement(521..>820) FT /locus_tag="GOS_264039" FT CDS complement(521..>820) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264039" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685164158; CAM_CL_1158" FT /inference="protein motif:Pfam (release 17):PF00410.7" FT /protein_id="EBB25567.1" FT /translation="ITKILFDKGYILNYKFESENGPQGNIKIALKYDLKTKSSAIKVLK FT RISTPGSRNYTGAKELPRVLNGLGIAILSTSKGVITDKEARNENVGGEVLCHIY" XX CO join(AACY024077616.1:1..820) // ID EP498503; SV 1; linear; genomic DNA; CON; ENV; 861 BP. XX AC EP498503; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550060 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-861 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-861 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-861 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-861 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6b7ea98bf2a27722c9857e5dcdae5dde. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..861 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..384) FT /locus_tag="GOS_264040" FT CDS complement(<1..384) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264040" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685407222; CAM_CL_11668812" FT /protein_id="EBB25564.1" FT /translation="MKRSQLILLSIGGILISGTLLFSQITFSGKGEVVAVRFLELKENV FT DVKDFEKFALEKYNPSFNRVVPGSRNFITKSDRGIDVGSYALIITFDSQIVRNTMIPEQ FT KSSEWLNTIMEENGLWSLWSELGA" FT gene complement(478..810) FT /locus_tag="GOS_264041" FT CDS complement(478..810) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264041" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685407224; CAM_CL_14270503" FT /protein_id="EBB25565.1" FT /translation="MNMSDDHIYDDINLTKRKTITNGIKYNFYIYKMLSLEKKLSNGKF FT GKGDTVISQIKNYRLQDDESEEMLEVKLKCSKKIDDSMNGFNPGNSKKIFDECLNDLEK FT RGMVKV" XX CO join(AACY024077617.1:1..861) // ID EP498504; SV 1; linear; genomic DNA; CON; ENV; 979 BP. XX AC EP498504; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550065 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-979 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-979 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-979 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-979 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 2f95a001a805d2630e5867e371373a2e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..979 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 140..433 FT /locus_tag="GOS_264042" FT CDS 140..433 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264042" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684936528; CAM_CL_12652" FT /inference="protein motif:Pfam (release 17):PF04248.2" FT /protein_id="EBB25561.1" FT /translation="MTIKIMKAVWNDTVIAESDDTVVVEGNHYFPSGSIKNEYFHKTET FT STSCPWKGVASYYSVTVNGKTNTDCAWYYPVPSKEAEKIKDRVAFWNGVQVI" FT gene 434..631 FT /locus_tag="GOS_264043" FT CDS 434..631 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264043" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684936532; CAM_CL_11269886" FT /protein_id="EBB25562.1" FT /translation="MVVCNTFLMVGPQDGGFGFDQSKKYTSVDNLDKICVQCQAGQHKK FT CLFKSKEQPECDCEHCLIYG" FT gene 652..954 FT /locus_tag="GOS_264044" FT CDS 652..954 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264044" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096684936526; CAM_CL_10082" FT /inference="protein motif:Pfam (release 17):PF03061.9" FT /protein_id="EBB25563.1" FT /translation="MTFNHNYLYKIKMEKTPDDSKAEVIIRMFPSDANPAGNVFGGAIL FT KHIDMVAGIVAQRFSQTNAVTVSMDKISFLKPVFVGNVLFVKARVNYVSKSSMGD" XX CO join(AACY024077618.1:1..979) // ID EP498505; SV 1; linear; genomic DNA; CON; ENV; 901 BP. XX AC EP498505; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550067 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-901 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-901 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-901 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-901 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6a5bf4318f4c518feb0d18b54f48462c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..901 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..698 FT /locus_tag="GOS_264045" FT CDS <1..698 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264045" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685155138; CAM_CL_2734" FT /inference="protein motif:Pfam (release 17):PF03030.5" FT /protein_id="EBB25559.1" FT /translation="GYAIGSAGLGALVLFAAYTEDIKFFSNVSGSNLENISVSFDLSNP FT FVVVGLLIGGMLPYLFGSMSMQAVGRAGGAVVVEVRRQFKQIPGIMKRKRKPDYGKLVD FT LLTKAAIKEMIIPSLLPVLSPIILYLIIYMIGGIEAALSAVGAMLLGVIVTGLFVAISM FT TAGGGAWDNAKKYIEDGKYGGKGSEAHKAAVTGDTVGDPYKDTAGPAVNPMIKITNIVA FT LLLLAVIAH" FT gene complement(701..>901) FT /locus_tag="GOS_264046" FT CDS complement(701..>901) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264046" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685155144; CAM_CL_10407" FT /protein_id="EBB25560.1" FT /translation="NYLKKNNILVLEFDKYGVLTKKEFYDKDQMKKITFAKDITENEIR FT KENFIYSFLSSIRQKMETKKK" XX CO join(AACY024077619.1:1..901) // ID EP498506; SV 1; linear; genomic DNA; CON; ENV; 913 BP. XX AC EP498506; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550069 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-913 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-913 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-913 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-913 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 961c60d39cdb01e56af3629201636273. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..913 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 13..276 FT /locus_tag="GOS_264047" FT CDS 13..276 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264047" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685275618; CAM_CL_3285" FT /inference="protein motif:Pfam (release 17):PF01053.9" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01325" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01326" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01328" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02080" FT /protein_id="EBB25557.1" FT /translation="MVLKLGKKFIEALKMFYHVANIGDARSLAIHPATTTHSQLTEEEL FT LAAGVTPGYVRLSIGIEHPDDIIADLDQALTASGRTKLKAVS" FT gene complement(269..>913) FT /locus_tag="GOS_264052" FT CDS complement(269..>913) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264052" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685275616; CAM_CL_4439" FT /inference="protein motif:Pfam (release 17):PF02628.5" FT /protein_id="EBB25558.1" FT /translation="IFFLICLQGFIGWYMVSSGLTERTDVSHYRLSLHLTLAFVIFILL FT VWNYLKITINYKNNHLSQIPFYLPAFFLIFILLQISIGALVSGLNAGEIYQSWPLMNQN FT YFPDDSNIKDLFGLNVFENPSLIQFIHRNLAYLIFLIFIIMLIIVFKNKNLFYLKKNII FT ILFAALLLQILLGILTILSGAQIILASLHQIGSIFLITASLILVFKNSKIN" XX CO join(AACY024077620.1:1..913) // ID EP498507; SV 1; linear; genomic DNA; CON; ENV; 880 BP. XX AC EP498507; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550071 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-880 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-880 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-880 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-880 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ea662bf974a97baf34a2a82de86e5a86. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..880 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077621.1:1..880) // ID EP498508; SV 1; linear; genomic DNA; CON; ENV; 818 BP. XX AC EP498508; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550073 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-818 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-818 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-818 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-818 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 41f5d6fc3e6315749a990244dd448c23. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..818 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077622.1:1..818) // ID EP498509; SV 1; linear; genomic DNA; CON; ENV; 915 BP. XX AC EP498509; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550075 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-915 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-915 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-915 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-915 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8215e541d6eb3780a8b23308bcc0bd5c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..915 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>915 FT /locus_tag="GOS_264053" FT CDS <1..>915 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264053" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685215944; CAM_CL_1507" FT /inference="protein motif:Pfam (release 17):PF01326.8" FT /protein_id="EBB25556.1" FT /translation="RGRGRGMSTCGPHVRGVVLCHALPHLSHLALRARQAQVPLIAIED FT EKLVDHAKSLANASAVKLSAAASNITLEETTESAKASTTAVAPGATAPEIHLNSDLSCG FT TSVLDLVELDRRGLEKSIAVAGTKSAMCARLSFIAEGSGDFSAPAGVVLPFGAMEFACA FT GIGKLEFLDSKLQELDDISNDPVRVRDTCEIIQTLVRSLRPSDETLQQIADKFGPGARV FT MVRSSANVEDLEGMSAAGLYDSIPNVDAYSKEALGHAISEVWASLFTTRAVASRAAAGV FT SHFEAHMCVLIQEMLSPEVSFVLH" XX CO join(AACY024077623.1:1..915) // ID EP498510; SV 1; linear; genomic DNA; CON; ENV; 924 BP. XX AC EP498510; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550081 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-924 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-924 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-924 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-924 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 04e11686bd35db853c9067b6ad017b0b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..924 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>924) FT /locus_tag="GOS_264054" FT CDS complement(<6..>924) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264054" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685264294; CAM_CL_11102632" FT /protein_id="EBB25555.1" FT /translation="IASNDGVPSKLLRVAKTVETYWKVSSKLTADANKQLLALNNLAQT FT FKDNNLPTDDVSLKGLTSTAIEISISNEEINQNKYSSEPIKILLDTAISKIVNLVKNTT FT ETVIEKNLQKKFDNATKELENNVEYTLGKTPILREIKKIGITDNPNPIFYFTSNLAGVI FT TFIGECNSNNKNAVEGENAIELATLSVGIYDNCSIKITTPEGNVSEALSFTKFTIIKKV FT DTTKPILTEIKKIEKYSTTNSPIYVFNSSEIGRIKVYGDCKSTHYNALKGNNSMFSLTS FT LALGKYTNCKITVTDESGNESLPLE" XX CO join(AACY024077624.1:1..924) // ID EP498511; SV 1; linear; genomic DNA; CON; ENV; 894 BP. XX AC EP498511; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550083 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-894 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-894 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-894 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-894 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f30fc0234f799cdd7805e6629b864df9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..894 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 287..820 FT /locus_tag="GOS_264055" FT CDS 287..820 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264055" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685565302; CAM_CL_212" FT /inference="protein motif:Pfam (release 17):PF03938.3" FT /protein_id="EBB25554.1" FT /translation="MKLIKHTLLTLSAFLLLSLPLSAADLNIATLDPQAALFSTNVAKQ FT ELEELENSDEWKEVVEELQAKAAEARDIQEKAQKDGPTMSDQEKQEAAQKLQSLQQDLN FT FLQEKTNQFRNQTLQLISQEQAEKFQVIVTELIRSKGITLLINSGGQQGTLLHADQSFD FT ITQEVIDAMNEKED" XX CO join(AACY024077625.1:1..894) // ID EP498512; SV 1; linear; genomic DNA; CON; ENV; 898 BP. XX AC EP498512; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550085 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-898 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-898 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-898 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-898 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 7083d88fe7c33f95dcfdf47c8787de84. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..898 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 499..>898 FT /locus_tag="GOS_264056" FT CDS 499..>898 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264056" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685804016; CAM_CL_368" FT /protein_id="EBB25553.1" FT /translation="MNFCKDRLIISKRLRMLIMNSYIKISLKIIIVCIGISACSSGGGG FT APVLVDNSVIISPTPEDQRYSFETFENKMTSPWGEVVFTYSVGEYRPSSELPSNEKYKI FT EDYGFLQVKAQGQHPGDDSNKDEISIEGA" XX CO join(AACY024077626.1:1..898) // ID EP498513; SV 1; linear; genomic DNA; CON; ENV; 980 BP. XX AC EP498513; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550088 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-980 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-980 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-980 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-980 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 1f69fa5d5c5fcab952ea92f7bacd71a9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..980 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>980 FT /locus_tag="GOS_264057" FT CDS <1..>980 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264057" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685204066; CAM_CL_513" FT /inference="protein motif:Pfam (release 17):PF00905.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02074" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02214" FT /protein_id="EBB25552.1" FT /translation="FSGRDGYGLEGLEKSYNSILTGKPLKERVLRDGARSTIQRLEVLE FT FGENSKDIYLTIDSNIQYIAYKYLVEAIKNNDGTGGTVIILDNSAREVLAMASYPSYNP FT NNPMRSIKKNRAFLESYEPGSIVKPLALAGAIEKNLIDIDTELELPIKIEVDGNIINDR FT EKYEQLKAYEIIKESSQVGATQISFLLGAERLIDNYKKFGFSKPVNINFPSTSFGEINS FT RDEISDIEIATLGYGYGLTATPFQISQAYAIFANKGTYYDFNIIKNNESQIFSEQIISE FT STANDILFSMRKVVEDGTGALAKLENFDVSGKTGTTEKLRDGNYK" XX CO join(AACY024077627.1:1..980) // ID EP498514; SV 1; linear; genomic DNA; CON; ENV; 954 BP. XX AC EP498514; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550090 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-954 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-954 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-954 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-954 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 20c7be46942470009834d8af1855a6de. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..954 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..641 FT /locus_tag="GOS_264060" FT CDS <1..641 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264060" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685415284; CAM_CL_4357" FT /inference="protein motif:Pfam (release 17):PF00346.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01962" FT /protein_id="EBB25550.1" FT /translation="LVDEYETLLTDNRIWKQRTVDIGVVTPERAMQLGFTGPMLRGSGI FT EWDLRRNQSYEVYDELDFLIPVGVNGDCYDRYLVRVEEMRQSNLIIQQCIKWLRANPGP FT VMIEDHKYRAPKRDSMKHDMESLIYHFKHFTEGYSVPEGNTYKAIEHPKGEFGVFLLSD FT GANKPYRLKVRAPSFAHLAAIDEMSKGHMLADVVSIIGTLDIVFGEIDR" FT gene 644..>954 FT /locus_tag="GOS_264062" FT CDS 644..>954 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264062" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685415286; CAM_CL_1161" FT /inference="protein motif:Pfam (release 17):PF01257.7" FT /protein_id="EBB25551.1" FT /translation="MSKVLTSQTIKEIDHWLGKFPKGKQRSAIIGSLHAAQHQNHGFLT FT AELMDAVAEYLDVPRIQVYEVASFYSMFQTKKVGKHEISICTNISCMLRGSDEILGYV" XX CO join(AACY024077628.1:1..954) // ID EP498515; SV 1; linear; genomic DNA; CON; ENV; 929 BP. XX AC EP498515; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550092 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-929 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-929 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-929 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-929 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a82d084be2651c14e9f1d2b7197cd7c9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..929 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 11..307 FT /locus_tag="GOS_264063" FT CDS 11..307 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264063" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685775162; CAM_CL_894" FT /protein_id="EBB25548.1" FT /translation="MILSEEEVLEALTDVTAQIIKTVRNALESTPPELAADIVDHGIVL FT AGGGSLLAGLDELLRNQVGLPIFHAEDPLTSVAVGTGKVLDELDLLSTIELDA" FT gene complement(311..>929) FT /locus_tag="GOS_264064" FT CDS complement(311..>929) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264064" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685775160; CAM_CL_4029" FT /inference="protein motif:Pfam (release 17):PF03917.6" FT /protein_id="EBB25549.1" FT /translation="KNSEAKKGRELIEHSSAIQTPDLWMQLAGMKKIQQALTRLEILSQ FT FAPTPWMPKMASTFVKMHSLGEDTIAPGESQNAMDLANENPESWVLKPQREGGGNNYFD FT TEMTQKLNVMTPSELKAHVLMERIRPLNHSAWLMVQGQSEYTSCVSEIGRYGVLLANRG FT TIELNSDCGYLVRTKSEDVNEGGVCAGYSCLNTLCLKEERVS" XX CO join(AACY024077629.1:1..929) // ID EP498516; SV 1; linear; genomic DNA; CON; ENV; 931 BP. XX AC EP498516; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550095 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-931 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-931 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-931 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-931 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 629de6aea7ee317a5d2fa78543a50fef. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..931 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(9..536) FT /locus_tag="GOS_264065" FT CDS complement(9..536) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264065" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685385510; CAM_CL_4846" FT /inference="protein motif:Pfam (release 17):PF03462.6" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00019" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00020" FT /protein_id="EBB25546.1" FT /translation="MFDYTKLSEELESLKSKTNNPNIWDNPKAKIFFQEIKILETRISD FT FKRIKQSLKDLEEFYKLAIDEKDEETLNSLINDSKKILNDSNNVRYLNLMNNEADSNSA FT FLEIHAGAGGTESQDWAMMLQRMYIRWAEDKNLKVVLLQESKGEEAGIKSSTMRIYRDF FT YLWMVKKRKWNS" FT gene complement(606..>931) FT /locus_tag="GOS_264068" FT CDS complement(606..>931) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264068" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685385512; CAM_CL_377" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02074" FT /protein_id="EBB25547.1" FT /translation="ALGVFVGFDKPKTLGYKQTGSAVAVPIFKKFMKEANINENKVPFR FT IPSGLSFVKIDQNTGLMTKDSDGILEPFIVGTEPYNNNIIKLDSLSSINNNSISGTGSL FT LLQ" XX CO join(AACY024077630.1:1..931) // ID EP498517; SV 1; linear; genomic DNA; CON; ENV; 871 BP. XX AC EP498517; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550098 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-871 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-871 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-871 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-871 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 093d9f4b88872930b41b8f09e1a2db74. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..871 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 82..>871 FT /locus_tag="GOS_264069" FT CDS 82..>871 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264069" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685584886; CAM_CL_11066756" FT /inference="protein motif:Pfam (release 17):PF01261.13" FT /protein_id="EBB25545.1" FT /translation="MSKIGFSASLTSGNLDTLSYQLDNFTNLGIDSVELPIYEIDIIVG FT KKILLSELKKLQSIISQYNFDFTVHGELSVNLMDEQYFEDHKEILKKDIEASGEIGATH FT LITHFGYTTNKIFENKSKYEDILKKQNDCYDELSSLAEKNNVTLAIECLFPFDKNFYAP FT LPSEIAFNLNKINNKRIKGCLDISHAYINCTYRNLHFINEIKEMAPLSEHIHMHDSFGI FT LQEMRTYIESEAVSYGFGDIHLPLGWGSIPFDKVFDSISLA" XX CO join(AACY024077631.1:1..871) // ID EP498518; SV 1; linear; genomic DNA; CON; ENV; 887 BP. XX AC EP498518; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550100 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-887 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-887 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-887 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-887 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e46ca1357d80b5f6702ac5847ded2e6a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..887 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>885 FT /locus_tag="GOS_264070" FT CDS <1..>885 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264070" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686075992; CAM_CL_11044804" FT /protein_id="EBB25544.1" FT /translation="DPYTAESVTDLMLQAEAAERIKQSEKSRTFYEKALKIPAKNLEER FT NKQKEILSFLSEGDLQEKIQAEDWAGISKQIRSESQSGLRPLNQKNFDLLVYAETQQKN FT WSGVLSAFELKKSRDPSSVNTLTALLIQAEAAEKLNEPIRARTFYRKALKVAPRNQEER FT RRQQEIEKFLSEEQLQKKIENQDWQGIVAQIHKEVGAKKRKLDQKSFDLLIYAETKLEN FT PEGILKAYGLLRRSDPKRAGSFNALVHQAQLADQIGKPALVQQYYRALLKLKPADETER FT EQQESIRNYLAEGG" XX CO join(AACY024077632.1:1..887) // ID EP498519; SV 1; linear; genomic DNA; CON; ENV; 930 BP. XX AC EP498519; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550102 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-930 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-930 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-930 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-930 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 35cb53e9113dbd79bd5e5720cbce6a39. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..930 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>929 FT /locus_tag="GOS_264071" FT CDS <1..>929 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264071" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685856686; CAM_CL_223" FT /protein_id="EBB25543.1" FT /translation="KTEDQAKTLRDFESRLAEETKAKKEAEAKLEKARKATDAADNKRK FT AAEAKTKEAEKAFESTVKPRKDAEDMAKKADSDRIRAEKELEKRVGLQKKAEEEAKKGA FT EDRKSAEKAKVDAEKAKADAEKARDKSIQETDKARKSLSESRAKLKDISEDLRKAEADR FT KAAQEKAASAKSEADELTKKAESSKSSAESAKNRLKEENAAGKEAKAQHAESKKRGEAA FT KKELATADEERKKAVAKMEEVVKAKQAYQKRASEERKKAEEVEEQVSQKRKLTADTKKK FT SEFEAKAKAEADAKAKAEADGHKKAKDD" XX CO join(AACY024077633.1:1..930) // ID EP498520; SV 1; linear; genomic DNA; CON; ENV; 874 BP. XX AC EP498520; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550106 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-874 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-874 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-874 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-874 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6bf02d6886da00cc938a029627cefd53. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..874 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(33..269) FT /locus_tag="GOS_264073" FT CDS complement(33..269) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264073" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685574512; CAM_CL_10017" FT /inference="protein motif:Pfam (release 17):PF00313.10" FT /protein_id="EBB25542.1" FT /translation="MLRRLKMPSGKVKWFNPNKGFGFIENDEGGDDVFVHISAVQESGL FT GTLNDNDHINFDIVDNRGKKAAANLSQLNSNEE" FT gene complement(317..838) FT /locus_tag="GOS_264072" FT CDS complement(317..838) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264072" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685574510; CAM_CL_532" FT /protein_id="EBB25541.1" FT /translation="MDKLIIRELYMKNLFLALIFGIFISLNFSIYSKNIDAETRFEIID FT VMNKYAIGIDTKNYPLFRSIFSDDVEVNIVYTSNFGSENNVFIKGANNWVKYVDKEVSI FT FRNTQHMLGNPMISYNGKVAIVRTDLRAIHYYADKPNNSTTFWGYYETHMVNNDGWKII FT KHTLTGIGTN" XX CO join(AACY024077634.1:1..874) // ID EP498521; SV 1; linear; genomic DNA; CON; ENV; 874 BP. XX AC EP498521; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550108 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-874 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-874 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-874 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-874 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a6423857ba0f04c82785817e071b9123. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..874 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..346) FT /locus_tag="GOS_264075" FT CDS complement(<1..346) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264075" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685764592; CAM_CL_8519" FT /protein_id="EBB25540.1" FT /translation="MKINNLKIFSILFIFLVSTPVLAKKMHGLAMHGQPKYDENFTYLE FT YVNPEAPKNGTIKFGSYGSFDNLNRVAFKGSRAAGLGYLNDTLMRRVWDEAFTIYGLIA FT EYVEMPDDRSS" FT gene 397..>874 FT /locus_tag="GOS_264074" FT CDS 397..>874 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264074" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685764588; CAM_CL_5735" FT /protein_id="EBB25539.1" FT /translation="MTKNNFLRYINSMKKILNSEITPYSAYINRRKFIKSLSTFSIIST FT LSMQAKAFHNKDSLKYNYLLDEGDKLNTYEEITTYNNFYEFGMGKSDPLNNSSLFNPKP FT WKIKIEGLVEKPFEIYLEDLLTKITIQDRIYRLRCVEAWSMVIPWQGFPLSDLIK" XX CO join(AACY024077635.1:1..874) // ID EP498522; SV 1; linear; genomic DNA; CON; ENV; 816 BP. XX AC EP498522; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550110 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-816 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-816 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-816 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-816 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 2826a23772ce102c5d408b8613870b6b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..816 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077636.1:1..816) // ID EP498523; SV 1; linear; genomic DNA; CON; ENV; 797 BP. XX AC EP498523; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550112 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-797 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-797 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-797 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-797 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 75d9e5c05e7258fe29a59282ce1df775. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..797 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>796 FT /locus_tag="GOS_264076" FT CDS <1..>796 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264076" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685465904; CAM_CL_2765" FT /inference="protein motif:Pfam (release 17):PF02785.7" FT /inference="protein motif:Pfam (release 17):PF02786.5" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00514" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01235" FT /protein_id="EBB25538.1" FT /translation="FAKILEDSKIKFIGPSSKLIKMMGDKIQAKKIAKKYGLPVIEGSD FT GGVSEIVKAKEISKKIGFPVLIKAAGGGGGKGMKIVFDENKFEELFLAAKTEAKKFFAN FT DEVYIEKFFQNPRHIEVQVLSGKNRTVHLHERDCSVQRRHQKLIEETPSPVLNDNLRKD FT LFEKTVNMVSKIGYEGAGTVEYIYEEGQFYFLEMNTRVQVEHPVTEMVTGIDIIKEQIW FT IAHTGNTALEQSDINPRGHAIECRINAEDASKNFQPSPGRIGM" XX CO join(AACY024077637.1:1..797) // ID EP498524; SV 1; linear; genomic DNA; CON; ENV; 944 BP. XX AC EP498524; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550114 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-944 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-944 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-944 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-944 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 91fdf037563b6f9e9f6fbb47b66d7f20. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..944 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..460) FT /locus_tag="GOS_264080" FT CDS complement(<1..460) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264080" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685995702; CAM_CL_5475" FT /inference="protein motif:Pfam (release 17):PF03480.3" FT /protein_id="EBB25536.1" FT /translation="MKKIIIYFLLFLMVLEFAVARKTIIKMATLAPEGTPWHALIAKMG FT ERWSEETNGNVRLRIYPGGIVGDERDMIRKMRIGQIHGAAISAEGLSEVNPQYTYCFIP FT LFFQGYEDIDFIRNQIKDDLVSGAEENGVKVLTMVDVGWVYWFTQGSCN" FT gene complement(476..>944) FT /locus_tag="GOS_264081" FT CDS complement(476..>944) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264081" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685995700; CAM_CL_7139" FT /protein_id="EBB25537.1" FT /translation="FENQDFDLFYWVAAAYGGAISSSGGNPKWIIKLPKVGKLLNSIID FT INPTWNNGAALVAKISFTMNNPLLSPSEADSISKSLFNAAIDASSGKDMGPYLTYAESV FT SKTRQNKEEFIFLLNEALKIKVKSEKNFQLTNTISKNRAEWLLNNIDEFFY" XX CO join(AACY024077638.1:1..944) // ID EP498525; SV 1; linear; genomic DNA; CON; ENV; 908 BP. XX AC EP498525; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550117 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-908 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-908 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-908 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-908 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a6bff1ae2c693bb2576cd51b2f300821. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..908 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 264..554 FT /locus_tag="GOS_264082" FT CDS 264..554 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264082" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685244754; CAM_CL_11326830" FT /protein_id="EBB25534.1" FT /translation="MMPIHLTFNNIRHSDAVSSHVNEAFEELIKITDNKFPFHVNLNKI FT APESYHVGINCSYKNKNLFSKADHENLYKALSKGIDSMKIQVIRKSEKVRN" FT gene 533..>908 FT /locus_tag="GOS_264083" FT CDS 533..>908 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264083" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685244752; CAM_CL_13062644" FT /protein_id="EBB25535.1" FT /translation="MRKSSKLKKFYSLKIIVLLFLFLDNLFMKEIFFLKKTFALAFILN FT IIFFIFLGFNFQLKGACRGEGFLGISSKDPIMSWVDLTFSPVYTSASTSGTSGCKNWDF FT PYEKYIEYVIKRFIENSEKQI" XX CO join(AACY024077639.1:1..908) // ID EP498526; SV 1; linear; genomic DNA; CON; ENV; 843 BP. XX AC EP498526; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550119 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-843 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-843 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-843 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-843 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b51a26f6104b022fd84a5ee49c3be879. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..843 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..345) FT /locus_tag="GOS_264084" FT CDS complement(<1..345) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264084" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686004732; CAM_CL_2894" FT /protein_id="EBB25532.1" FT /translation="MVNIVIWSSDHLVIWFSGHLVIWSSGHLVILSSGQLVNMVIRSIW FT SSGHLAIWSSGYLVNMVIWPSGQYRHLVIWSIWSSGHLVIWSSGHLVIWSSGHLVIWSS FT VHLVFWSKWSK" FT gene complement(<1..304) FT /locus_tag="GOS_264085" FT CDS complement(<1..304) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264085" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686004734; CAM_CL_2894" FT /protein_id="EBB25533.1" FT /translation="MVFWSSGHLVIWSSGDLVIWSTGQYGHQVNMVIWSSCHLVIWLSG FT QYGHLAIWSISPSGHLVNMVIWSSGHLVIWSSGHLVIWSFGHLVICSSGLLVKMVK" XX CO join(AACY024077640.1:1..843) // ID EP498527; SV 1; linear; genomic DNA; CON; ENV; 828 BP. XX AC EP498527; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550121 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-828 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-828 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-828 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-828 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b7e8e67efc7b10ba048365237a618e35. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..828 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077641.1:1..828) // ID EP498528; SV 1; linear; genomic DNA; CON; ENV; 894 BP. XX AC EP498528; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550123 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-894 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-894 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-894 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-894 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 7251e1908a383daf8c117498a70b6c34. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..894 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(2..>894) FT /locus_tag="GOS_264086" FT CDS complement(2..>894) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264086" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685515364; CAM_CL_467" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01982" FT /protein_id="EBB25531.1" FT /translation="TKNDVGFYVPKIYWNFTSEEILTLDWIDGVSIREKEILESKKINI FT ENLATDIIQHFLRHAVRDGFFHADMHQGNLFIDDNGRIIPIDFGIMGRMDKLNRRYLAE FT ILYGFVKRDYKKVAEVHILAELVPNNVNVGELAQALRSIGEPIFGQSVKDISGGKLLKQ FT LFDVTEKFNMQTQPQLLLLQKTMVVVEGVARKLNPNTNIWETSKPVLEKWLKETKDPIN FT NLTQTLKDSTEVIKKIPELPKIMDKANQALTFMASGKIPQESNSFSALNEKKLEMKSFR FT NQSIIGLLLLVFLDS" XX CO join(AACY024077642.1:1..894) // ID EP498529; SV 1; linear; genomic DNA; CON; ENV; 793 BP. XX AC EP498529; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550125 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-793 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-793 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-793 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-793 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9d269c44e8ed8996ecdd8e91cf10f8a4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..793 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077643.1:1..793) // ID EP498530; SV 1; linear; genomic DNA; CON; ENV; 962 BP. XX AC EP498530; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550127 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-962 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-962 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-962 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-962 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 571b06a1d56b21db792aa29e67514b0f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..962 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..498) FT /locus_tag="GOS_264087" FT CDS complement(<1..498) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264087" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685395452; CAM_CL_1807" FT /protein_id="EBB25529.1" FT /translation="MLTIQNTVSDMAKKTLIIAPHPDDETLGCGGTILRRKNEGAEVAW FT LIVTSISEEGGWSSDRVLSRDEEITEVQKRYSFDEVFNLGYPSIELDNISIRDLVDSFS FT NIINDYKPNEIFAPHRGDVHSDHRIVFDAVMACSKWFRYPSLTTFYSYETASETEFNLY FT KGT" FT gene complement(587..>962) FT /locus_tag="GOS_264088" FT CDS complement(587..>962) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264088" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685395454; CAM_CL_8768" FT /protein_id="EBB25530.1" FT /translation="SHDWLSLSEMNIEVCSKIMTWLNIDIPIMKSSEIGAQGKSSELIL FT NICSEVGATRYISGIGGKNYLDINDFEDKGIYVDFQKPLNLRPYPQLHRKHEFMSDLSA FT IDIIFNCGNKWSTYLSEKID" XX CO join(AACY024077644.1:1..962) // ID EP498531; SV 1; linear; genomic DNA; CON; ENV; 955 BP. XX AC EP498531; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550129 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-955 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-955 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-955 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-955 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 4a1f4e2f213c1b6b300b08552c5dd6ee. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..955 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..577 FT /locus_tag="GOS_264089" FT CDS <1..577 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264089" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686064488; CAM_CL_3280" FT /inference="protein motif:Pfam (release 17):PF01182.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00502" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01198" FT /protein_id="EBB25527.1" FT /translation="EVCLRGNKHSYHYYMMSNFFDHTDIQKKNVHLPDGCAEDLRESCR FT KYENLINDAGGVDLQVLGIGANGHIGFNEPTSSFASRTWVKILSKQTIQDNSIYFDKME FT EVPRHVVTMGIATIMESRHCLLIVNGAKKADAIRNMIEGPVSASCPASILQMHPRVTII FT LDEEASYLLTFKDHYKWVEKNKLDWQLY" FT gene 601..>955 FT /locus_tag="GOS_264092" FT CDS 601..>955 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264092" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686064490; CAM_CL_774" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00221" FT /protein_id="EBB25528.1" FT /translation="MPIIELPSSTENNINSESSRKEFAIDDSLFLSAESRINKTPGLVD FT LQVNGFAGVDFNSPGITTQTLQIAFEAMLASGVTTCLPTLISASEQRLETCFSALENPD FT NPANWQKDDCRLPS" XX CO join(AACY024077645.1:1..955) // ID EP498532; SV 1; linear; genomic DNA; CON; ENV; 915 BP. XX AC EP498532; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550131 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-915 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-915 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-915 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-915 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 92f5d1d3c406d098a120270395b94bea. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..915 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>914 FT /locus_tag="GOS_264093" FT CDS <1..>914 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264093" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686355098; CAM_CL_207" FT /inference="protein motif:Pfam (release 17):PF00724.8" FT /inference="protein motif:Pfam (release 17):PF00890.13" FT /inference="protein motif:Pfam (release 17):PF01266.11" FT /inference="protein motif:Pfam (release 17):PF03486.4" FT /inference="protein motif:Pfam (release 17):PF07992.1" FT /protein_id="EBB25526.1" FT /translation="VPRAAFAWVTGKLRPYLKIPVVTSNRINDPFVAENLLRDGIADMV FT SMARPFLADENFVKKTEEGRPEEINTCIACNQACLDNIFKMKTASCMVNPRAGRETELN FT YQPAAKPKSIAVIGAGPAGMTAAYVSAMRGHTVTLFDQRKELGGQINYAVKIPGKQEFF FT EVIRFYKVMLKKYGVEIKLGHIISPQSPLTGKYDAVVLATGVRPRKLELEGADHSKVLS FT YLDVLDKGRAVGRKVAVIGAGGVGIDVAHYLTAQTPFSGDVPDYLQGHGILDSNEALEV FT RKPKKREVTVLQRSSDKIGKRLG" XX CO join(AACY024077646.1:1..915) // ID EP498533; SV 1; linear; genomic DNA; CON; ENV; 972 BP. XX AC EP498533; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550133 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-972 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-972 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-972 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-972 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 86edd85f6714a46e3648a71a6323b23f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..972 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..851) FT /locus_tag="GOS_264098" FT CDS complement(<1..851) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264098" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686224886; CAM_CL_317" FT /inference="protein motif:Pfam (release 17):PF01367.9" FT /inference="protein motif:Pfam (release 17):PF01612.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00593" FT /protein_id="EBB25525.1" FT /translation="MTNKRVHDGLKKCQDDALLSKELVTIIKNVDIECSIENFVVQSFD FT QDALVKKYEELEFHALLKQIRGTNNSLKTSKIEKKYTSITSKKDLQELINNIETSDLIS FT IDLETTSVNPMTADIVGISISCKTNSGFYVPILYPEKEKNNFGEDDLMEVLSLIKKVLE FT DSSIKKVGQNIKYDSLILSRHGIRIAGIYFDTMIAAHILNPASRSYKLDTLSIEYLNYN FT MVPIEDLIGSGKDQITMERVPLDEVTFYASEDADIALQIAKLFIPRLEENNQMDFFQRI FT EIP" XX CO join(AACY024077647.1:1..972) // ID EP498534; SV 1; linear; genomic DNA; CON; ENV; 810 BP. XX AC EP498534; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550135 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-810 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-810 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-810 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-810 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; bd782ca82e0c50d315ee3e6e820c4930. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..810 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 68..514 FT /locus_tag="GOS_264101" FT CDS 68..514 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264101" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686618060; CAM_CL_10670" FT /inference="protein motif:Pfam (release 17):PF00692.9" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00576" FT /protein_id="EBB25524.1" FT /translation="MNNMNLNIKPLSDDIYSMYNNHSHFHQGDAGLDLFITKDQVILPG FT TTARIHLGISCENMDSKPYLLMARSSISKTPLRLSNSVGLIDASYRGEIMAAVDNIKDF FT SFSLEKGQRLFQLVSMNGDAIHFELVDTLSKTSRGEGGFGSTGE" XX CO join(AACY024077648.1:1..810) // ID EP498535; SV 1; linear; genomic DNA; CON; ENV; 894 BP. XX AC EP498535; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550137 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-894 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-894 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-894 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-894 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 465445c3fe22cde7a86ecaa3312fc52b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..894 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..650) FT /locus_tag="GOS_264103" FT CDS complement(<1..650) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264103" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685895368; CAM_CL_499" FT /protein_id="EBB25523.1" FT /translation="MENKNICIVYSHTKVGDLIWQLPYIKAISLYHKKNIVLITREETR FT AKIIFKDLDYIEVVKYNQFRKNINYWIDTFKLFKFLKSGYFSHLYVLDKISRPAIAAKF FT AGIKNIIGPGLGNQKKWLTCKNFFNEEDWNLTYSDQSQKLLLLNNISVKNIFPELKINF FT ERDDIDINIKKIDNKIISFGIDSSEEFRMWYEELFVELANVLFEKNLFEKIYL" XX CO join(AACY024077649.1:1..894) // ID EP498536; SV 1; linear; genomic DNA; CON; ENV; 886 BP. XX AC EP498536; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550143 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-886 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-886 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-886 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-886 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; fc7382f1fec6bbb6f68426804699ff76. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..886 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 313..864 FT /locus_tag="GOS_264104" FT CDS 313..864 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264104" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686105468; CAM_CL_460" FT /inference="protein motif:Pfam (release 17):PF00768.10" FT /protein_id="EBB25522.1" FT /translation="MGKTMISKFNIGLNYCKHTIFMVILLVTLLCAVRAESFESSAKSA FT LVIDNLTGNILLEKNSGERIPPASMSKLMTLYMVFDALRHERLLLTDMIKVSAKASRKG FT GSKMFLNEGQMVSIEDIIRGIIIHSGNDACIAIAETLSGTEAEFAKDMTEKAKTLGLTN FT SSFTNSTGWADEIIICRPKI" XX CO join(AACY024077650.1:1..886) // ID EP498537; SV 1; linear; genomic DNA; CON; ENV; 966 BP. XX AC EP498537; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550145 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-966 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-966 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-966 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-966 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 305b6a6d02f7fdb9da519a6a414002ed. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..966 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077651.1:1..966) // ID EP498538; SV 1; linear; genomic DNA; CON; ENV; 976 BP. XX AC EP498538; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550147 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-976 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-976 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-976 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-976 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e8498eb6ac0642e29da2a313bf987915. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..976 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(47..418) FT /locus_tag="GOS_264105" FT CDS complement(47..418) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264105" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685524702; CAM_CL_11228" FT /protein_id="EBB25520.1" FT /translation="MDLSNPDGTGNLSITKMSIESDSVSFDFEGKVEGYGSVFCSHVMS FT AVDGDRTRGVMSGEARTFLEDGTFITSPHRGTFKRDKSNIRLFFTDAVNNGAVNFVIWN FT IDILSKSVEVKYWEIDKAE" FT gene complement(511..>976) FT /locus_tag="GOS_264106" FT CDS complement(511..>976) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264106" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685524700; CAM_CL_5362" FT /protein_id="EBB25521.1" FT /translation="EFNWWESYSVEGFTLTFTPVQHWSKRGLFDRNKSLWGGWYFNFDD FT YSMYHAGDTGYSNDFIDTRLRLGAPKYAFIPIGAYNPEWFMAESHVNPEDAIQVMLDLE FT AEKAFGMHWGTFALTDEDTLEPPARLKEALKSFNSPDFISLIPGKVIKIK" XX CO join(AACY024077652.1:1..976) // ID EP498539; SV 1; linear; genomic DNA; CON; ENV; 949 BP. XX AC EP498539; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550151 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-949 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-949 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-949 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-949 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9bcd3821a116108f3a43bcc41b88a99d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..949 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 502..>949 FT /locus_tag="GOS_264107" FT CDS 502..>949 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264107" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685475344; CAM_CL_807" FT /protein_id="EBB25519.1" FT /translation="MFMKIYPKRVEFDINEYDSNNKSKKSKFGLPEEVIFCKKCVISNQ FT RPNSAIEYAHNINTVKKTINIDNEGICDACKHAEQKKATIDWEQRHKELQELCDKHRSN FT DGSYDCIVPGSGGKDSFYASHVLKYKYGMNPLTVTWSPHMYTPWG" XX CO join(AACY024077653.1:1..949) // ID EP498540; SV 1; linear; genomic DNA; CON; ENV; 966 BP. XX AC EP498540; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550154 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-966 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-966 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-966 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-966 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6578eb879923c232620da8a3e7b28b4f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..966 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(160..909) FT /locus_tag="GOS_264108" FT CDS complement(160..909) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264108" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686015796; CAM_CL_4387" FT /inference="protein motif:Pfam (release 17):PF00117.14" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01368" FT /protein_id="EBB25518.1" FT /translation="MIAGSEVTEADIENKALREAKGFEGLQGMDLAKVVTQPARSWTQS FT RWSIRDGYTQQTETKFKVVAYDFGIKNNILRLLAGKGCDLTIVSAQTTADEALKLKPDG FT IFLSNGPGDPEPCDYAISAIRKFFELEIPVFGICLGHQLLSIASGAKSLKMDHGHHGAN FT HPVKDLETGAVVITSQNHGFAIDESSLPGNLECTHRSLFDGTVQGVRRLDLPVFGFQGH FT PEASPGPQDCEYLFDRFIDLMNEKRNA" XX CO join(AACY024077654.1:1..966) // ID EP498541; SV 1; linear; genomic DNA; CON; ENV; 816 BP. XX AC EP498541; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550156 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-816 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-816 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-816 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-816 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 219d092f4089a2024e53ae65194f7ce4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..816 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>814 FT /locus_tag="GOS_264110" FT CDS <1..>814 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264110" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685727290; CAM_CL_197" FT /inference="protein motif:Pfam (release 17):PF00012.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01991" FT /protein_id="EBB25515.1" FT /translation="AKIELSTSQQTEINLPYITADQSGPKHLVMKLTRAKLESLVEELV FT SNTIIPCRTALDDAGQTVNDIDDVILVGGQTRMPLVQEKVKEFFGKEARKDVNPDEAVA FT MGAAIQAAVLAGDVTDVLLLDVTPLSLGIETMGQVMSVLIEKNTTIPTNKTQVFSTADD FT NQTAVTIHVLQGERKQAGQNKSLGRFDLTDIPPAPRGMPQIEVAFDIDANGILNVSAKD FT KATGKEQSIIIQASSGLSDEEIDKMVRDAEAHSEEDKKFEEMVVLRNQA" FT gene complement(167..352) FT /locus_tag="GOS_264112" FT CDS complement(167..352) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264112" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685727296; CAM_CL_784" FT /protein_id="EBB25516.1" FT /translation="MSCQDSCLNGGSHRNSLVRVNVFPRFFSKKFFNFFLNQWHTSLSA FT NQNHIIDIIYCLPSII" FT gene complement(428..703) FT /locus_tag="GOS_264113" FT CDS complement(428..703) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264113" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685727292; CAM_CL_784" FT /protein_id="EBB25517.1" FT /translation="MNNNGLLFTSSLILRRNIQDAISINIKSNLNLRHASGRRRNISEV FT EPPQRFILPSLFTLPLQYVNRYRGLIVIGSRKNLGFVSWYSCILFY" XX CO join(AACY024077655.1:1..816) // ID EP498542; SV 1; linear; genomic DNA; CON; ENV; 938 BP. XX AC EP498542; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550158 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-938 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-938 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-938 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-938 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 51b9af6bb77decc2183c678250c637e2. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..938 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..191 FT /locus_tag="GOS_264114" FT CDS <1..191 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264114" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685367026; CAM_CL_11726748" FT /protein_id="EBB25512.1" FT /translation="KPAKEISIKKSDKQVKSLLSGWIPLNKVALKNWLGIDSDKHIFSF FT EGLSQMLSRERLFGKKM" FT gene 233..586 FT /locus_tag="GOS_264115" FT CDS 233..586 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264115" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685367020; CAM_CL_11473803" FT /protein_id="EBB25513.1" FT /translation="MANIAEGYVCIESNDKDLLSDLKEKISQKNQIFSYGGPVDIMEGS FT IDGTDYLEAHFTGRWSCDSAWSFFDDLIKDPDYKHQQALIDSQIEGKETEDGAEESRIK FT CFKLPGEEALPTI" FT gene complement(651..>938) FT /locus_tag="GOS_264116" FT CDS complement(651..>938) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264116" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685367022; CAM_CL_10035" FT /protein_id="EBB25514.1" FT /translation="GRAANGIIVKGPEAHAAFLKEWFATSNPSWKFDYAMANDVLLTDG FT THQHWVTSAYTLTDTINGEEVVTEELFDVEIKNGKIKTILVASRVVIAEE" XX CO join(AACY024077656.1:1..938) // ID EP498543; SV 1; linear; genomic DNA; CON; ENV; 841 BP. XX AC EP498543; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550161 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-841 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-841 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-841 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-841 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 44d640848a80e84e624bb81c597de74d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..841 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(156..>841) FT /locus_tag="GOS_264117" FT CDS complement(156..>841) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264117" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685926422; CAM_CL_24" FT /inference="protein motif:Pfam (release 17):PF02272.7" FT /inference="protein motif:Pfam (release 17):PF07973.1" FT /protein_id="EBB25511.1" FT /translation="NSNYFSTELCGGTHVKNTGDIGKFKIITQSSIAAGVRRVEALRDK FT QLEDYLKNKEKLSDITSQKDVETIKELSEKIIKLGGKPSLDNEDQKSLIKDLSKQLDQL FT NVRSILEDESKNLIKDETINGVKLRLQKVEDLPPKDLRKLVDIGKKELKEGIVVVFANK FT DEKVGIAVGITEKLTEKYNAVEFAKIGSEIIGGKGGGGRKDFAQAGGLYVDKIEEAFNK FT LKSLI" XX CO join(AACY024077657.1:1..841) // ID EP498544; SV 1; linear; genomic DNA; CON; ENV; 904 BP. XX AC EP498544; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550163 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-904 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-904 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-904 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-904 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; cd19e60e004c00071beaa4b0e81b12f5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..904 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(179..>904) FT /locus_tag="GOS_264119" FT CDS complement(179..>904) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264119" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687005444; CAM_CL_5298" FT /inference="protein motif:Pfam (release 17):PF00753.15" FT /protein_id="EBB25510.1" FT /translation="GNCDPLEPKNTRLRCSLLVQKLGNSGITNVLIDTSPDMRSQLIKT FT SIGILDGVIYTHYHADHINGIDDLRMIVLNRKSRLKVWADSPTKIRLTKCFDYIFEQLE FT GSSYPAILDINSIEQKTIISGPGGDIAFEAIQVNHGNIDALGFKIGNVAYVPDVLEFYE FT KSKPLLANLQYLIVDALRYRPHASHAHVDKSLSWIAEFKPQHAILTNLHNDLDYSTLNA FT ETPDNVTPAHDGLSFKIYE" XX CO join(AACY024077658.1:1..904) // ID EP498545; SV 1; linear; genomic DNA; CON; ENV; 925 BP. XX AC EP498545; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550165 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-925 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-925 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-925 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-925 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 1658e724e9bbd2cb0032f4b409cab8e5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..925 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077659.1:1..925) // ID EP498546; SV 1; linear; genomic DNA; CON; ENV; 986 BP. XX AC EP498546; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550167 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-986 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-986 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-986 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-986 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 3cc506e33f2122f243a6a99efe268d89. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..986 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 39..>986 FT /locus_tag="GOS_264120" FT CDS 39..>986 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264120" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685238294; CAM_CL_1374" FT /protein_id="EBB25509.1" FT /translation="MILPSARPAIVAGLSLVAMECLSDFGTVSFFSVSTLTTGIYNSWL FT AFDDLNTANQLSFILLIIILFLFYLENYSRGAAKYHQNSNSGFRKIPKIEMKHTNSFLV FT ASFCFILFFLSFIFPLSQMLYWTLKFPKYFHDLNIISLNLNTLMLVFLASLVLISFAFL FT INFGNRISKSKFLDNLSLFSISGYAIPGVILAVAFITFFSWLSDNLVESFGFISIKKIF FT IGSILGLIAAYFIRFYSLAFNGIKSSYLKINHSIDESSYLLGYSKFRTFRKIHFPHLRN FT SIFLIGVLIAIEIIKELPITLILRPFNFETFATTA" XX CO join(AACY024077660.1:1..986) // ID EP498547; SV 1; linear; genomic DNA; CON; ENV; 876 BP. XX AC EP498547; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550169 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-876 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-876 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-876 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-876 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 3f5b6e8144e21983f0b20aa004b5974c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..876 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..867 FT /locus_tag="GOS_264121" FT CDS <1..867 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264121" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685816060; CAM_CL_5211" FT /protein_id="EBB25508.1" FT /translation="VLWTLTGDYNHPADERIMQAEEDLPHETLEAYESLSEKEKIEFDR FT HDAAELLSQFLHGEQGALLVASQLTACAPTYNAKLYAASQTFDEARHVEVFNRYLQEKI FT GMHYPINQNLKLLLDKILTDPRWDLKFIGMQIIIEGLALAAFQMLKSLSKDPLLTQLLH FT YIIRDEARHVTFGINYLEDFIKTLTPEEIEERAEFAYEACVISRERLINTKAMQKYLKM FT SEEEARKFALSTTANTAFTNFLFTRIMPNLSRIGLLTDKVRPKFEALGLLEYEHAPDDF FT ECDWNEL" XX CO join(AACY024077661.1:1..876) // ID EP498548; SV 1; linear; genomic DNA; CON; ENV; 862 BP. XX AC EP498548; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550172 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-862 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-862 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-862 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-862 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; dfcd7157944942f5783338491e02d04a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..862 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..566) FT /locus_tag="GOS_264122" FT CDS complement(<1..566) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264122" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685785242; CAM_CL_6496" FT /inference="protein motif:Pfam (release 17):PF02567.5" FT /protein_id="EBB25506.1" FT /translation="MRLNFYTIDVFTNKIFGGNPLAVFLDADKLSSIQMQSIAREINYS FT ETAFVLKPQNKKNTAKVRIFTPKNELPFAGHPNVGTSYLLLKKINLIPGEFNKFEMWFE FT IKAGLVRILPKINKENIILGTSIEAPQRLKLSEKVSLSIISECIELNENQIYVKNFEPI FT IASVGLDFVIAEVESRKVLSSARCN" FT gene complement(591..>862) FT /locus_tag="GOS_264123" FT CDS complement(591..>862) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264123" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685785244; CAM_CL_211" FT /protein_id="EBB25507.1" FT /translation="GRMELPVPFNPIADKRSKINLWQNTSHPSQEPKVIELEAEDQYKV FT QIEMMNEKIQNGLPFQFSLEDSYKNMQVLDKIVLSSKSGMWEEI" XX CO join(AACY024077662.1:1..862) // ID EP498549; SV 1; linear; genomic DNA; CON; ENV; 834 BP. XX AC EP498549; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550175 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-834 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-834 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-834 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-834 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 1285d057b2b03cf28cead75ba4a92c22. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..834 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..683 FT /locus_tag="GOS_264124" FT CDS <1..683 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264124" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685825584; CAM_CL_1211" FT /inference="protein motif:Pfam (release 17):PF06426.2" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01172" FT /protein_id="EBB25505.1" FT /translation="LAFVLANKLASNVLLDSQLLEMFSAQYRRDGMLVKRAQADMQAVM FT DRDPACEEYTQILLFFKGFQAVQAYRVANALWLDDRKPLALLLQSRISEIFHVDIHPGA FT TIGEGVMLDHATGVVIGETAVVGDNVSILHGVTLGGTGVKDGDRHPKIGDGVVIGAGVT FT ILGNIRVGANSKIGAGSVVLKEIPENCTAVGIPARLVGGPKPSAEPSLDMDQVSGLADY FT VYNI" XX CO join(AACY024077663.1:1..834) // ID EP498550; SV 1; linear; genomic DNA; CON; ENV; 841 BP. XX AC EP498550; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550177 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-841 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-841 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-841 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-841 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e9fb40c27c755530590193a724d3f0d4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..841 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077664.1:1..841) // ID EP498551; SV 1; linear; genomic DNA; CON; ENV; 956 BP. XX AC EP498551; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550179 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-956 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-956 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-956 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-956 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6305f9e1bfb70f7f9dedec7bbbc74888. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..956 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077665.1:1..956) // ID EP498552; SV 1; linear; genomic DNA; CON; ENV; 951 BP. XX AC EP498552; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550181 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-951 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-951 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-951 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-951 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 5dd0e1b0f004d69070715e8216809d96. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..951 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 39..776 FT /locus_tag="GOS_264126" FT CDS 39..776 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264126" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685425532; CAM_CL_336" FT /inference="protein motif:Pfam (release 17):PF02518.12" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01386" FT /protein_id="EBB25504.1" FT /translation="MKISSKDELGELAKTINKMTLDINRLVNQKQNLLIDVSHELKTPL FT TRLKFIIANMKINNTQKNELNKEINFLQDMISNMLLSDKLSTPYIEDLEKKEVLLELLI FT KNTCDMFYEIDKKLTIIDHTDKKQTVYVDKYKISLAIKNLIDNALKYGHREKKNELILE FT NFSETIKITVQDYGAGVSKEQIEEIVKPLYRGQSAQEKSKTGFGLGLAITKKIIEAHNG FT NLKIESKINNGSKFIVTIPKGQI" XX CO join(AACY024077666.1:1..951) // ID EP498553; SV 1; linear; genomic DNA; CON; ENV; 937 BP. XX AC EP498553; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550183 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-937 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-937 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-937 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-937 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b23b1330ada9d83189d96e53a93f2f36. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..937 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>937 FT /locus_tag="GOS_264128" FT CDS <1..>937 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264128" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685974706; CAM_CL_159" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01187" FT /protein_id="EBB25503.1" FT /translation="GVEEVHVHDTSRRERAEFSYQLGGIFQVRYKIYRQKFFIKFVNNF FT IQQLGPFFFYSIGGYLVIKGSLEVGTLMAAIAAHKDLASPWKELLGYYQKQADSKIKYD FT QVISQFEPVDMIDENAQTEEPKDENSLSGELSLTNVVLNDDQETAVVDGANIKFSLNET FT VALVGSPGSGREDLAMLLARLIQPSSGSINLAGNDIANAPESLTGRRMSFVGSGGYVFS FT SSLADNLYYGLRHKQISDNPDPEKAKEFQSTISTSEASGNSTDDPNAIWTDYLAAGASD FT DDSLVEQALRVLEIADLTDDVYQLGLRGTIN" XX CO join(AACY024077667.1:1..937) // ID EP498554; SV 1; linear; genomic DNA; CON; ENV; 897 BP. XX AC EP498554; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550185 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-897 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-897 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-897 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-897 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f42a75dab5921f7fe483beca926b138f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..897 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 94..846 FT /locus_tag="GOS_264129" FT CDS 94..846 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264129" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685616190; CAM_CL_1695" FT /inference="protein motif:Pfam (release 17):PF07722.2" FT /protein_id="EBB25502.1" FT /translation="MYNKPTVGILAGTMEKDSIYWHSVGESNLFALNQVSECNPIIIPA FT LGNKLNFLDILNNLDGLFLGGGATNIHPNNYSNNVDRDKDIYDEKRDSTSIPLIKLAIK FT IGIPIFAICRGFQEVNVALGGSLHSYLHEVPGKFDHRRDRTKTLEYQTLPSHNVTINKD FT GLIYKILNKNNIKVNSLHGQGIDKLGKNLQIEATAQDSTIEAISIKNTNSWTLGVQWHP FT ELSLDHDCVSKELFKSYGNACRNIKKNR" XX CO join(AACY024077668.1:1..897) // ID EP498555; SV 1; linear; genomic DNA; CON; ENV; 881 BP. XX AC EP498555; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550187 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-881 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-881 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-881 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-881 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 1720f30ff8d37569ae4e81a89b608386. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..881 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(281..>881) FT /locus_tag="GOS_264130" FT CDS complement(281..>881) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264130" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685666104; CAM_CL_3723" FT /inference="protein motif:Pfam (release 17):PF03989.2" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01063" FT /protein_id="EBB25501.1" FT /translation="GRVTAGVRGMKLKDGDSVVGMIATSNEDTHVLTLSKYGMAKRSRL FT GDGEMHDIEPTVKDEKTGKNKQYRDGYRKTNRGAGGVATMKLDEEHKDEIVRVHTIPDL FT GDQLFILTGKGMMIRVRADQTKETSGKSTKGTRVMELRDKEKGGFVDEIIFTARLPAEL FT IDEEDEFDSLDTNQDGVIDREEFDAAQQEIVGGEEE" XX CO join(AACY024077669.1:1..881) // ID EP498556; SV 1; linear; genomic DNA; CON; ENV; 858 BP. XX AC EP498556; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550190 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-858 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-858 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-858 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-858 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 081b9f2e6fcc0c04f1b711fd15f2976a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..858 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..770 FT /locus_tag="GOS_264132" FT CDS <1..770 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264132" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685745012; CAM_CL_4235" FT /inference="protein motif:Pfam (release 17):PF00535.13" FT /protein_id="EBB25500.1" FT /translation="FIIVINDASTDKSEIEISSTDKIKSIKIIKMNENRGHARCNASGL FT KYIFENEEFDYIIPMDGDGEDRPEEIEKFVEFLKYDNSKPIVGERIKRSEGFIFTLSYN FT IHKLITYIFTGQSIKFGNYTCLPKTTVEKMINEKATWSSFSGSLAKVEKNRSTIPSIRG FT SRYFGPSKMSFFDLIKHSLSIIAVFRTNVIIRSILFFLIYLFLISENLSYVTSIPLIGV FT LALAISVLAISKRENISELNDSLSNINNIDEIK" XX CO join(AACY024077670.1:1..858) // ID EP498557; SV 1; linear; genomic DNA; CON; ENV; 831 BP. XX AC EP498557; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550192 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-831 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-831 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-831 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-831 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e8dd999578e4f8a0ea467897b7df3a3d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..831 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..534 FT /locus_tag="GOS_264133" FT CDS <1..534 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264133" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685935316; CAM_CL_8372" FT /inference="protein motif:Pfam (release 17):PF00826.7" FT /protein_id="EBB25498.1" FT /translation="IIWAPKQVSTWAKKNPAHMFRGKKKAYTRKKYIGGVPASRITQFD FT VGAAKTDFAVKVTLSAQEECLIRHNALESARVTANRYIQTHAGREGYHLKVRTYPHHVL FT RHNKIAQGAGADRVSMGMRKSFGRTVGTAARVSSGQKLITLSTSEEFLLEAKEALRKSS FT HKLPTPCSIKVNEG" FT gene 535..786 FT /locus_tag="GOS_264134" FT CDS 535..786 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264134" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685935318; CAM_CL_13249904" FT /protein_id="EBB25499.1" FT /translation="MAEVVKKLGLPGQDGFLYFVEKDGTVWKHQGGKKTLISDSKVERE FT EGYLYFIDLNGDLAKKANPQQRDAETNKLYKPGTQVER" XX CO join(AACY024077671.1:1..831) // ID EP498558; SV 1; linear; genomic DNA; CON; ENV; 844 BP. XX AC EP498558; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550194 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-844 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-844 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-844 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-844 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9b576885ea1429508deb7665b3c5cee4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..844 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>844 FT /locus_tag="GOS_264135" FT CDS <1..>844 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264135" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686024492; CAM_CL_703" FT /inference="protein motif:Pfam (release 17):PF00595.10" FT /inference="protein motif:Pfam (release 17):PF02163.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00054" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02037" FT /protein_id="EBB25497.1" FT /translation="ELLKKYSKEDQEKLFVVKPLYQRSIIVAAGPFANFLLAIFIFAFI FT YMFAGKDFTPAQIKEVQIESPAKEAGIKSGDIIKSINGKDVNSIMEVSAFINSSSSEKI FT DIGILRNDSEIRFSVKPEIIKGEDSLGNKANKKIIGIKIAPLNDEINRERLGPATALFY FT AFKETWFVIDASWNFIISMFKGTGDTTQLGGPIKIAKITGQVAKMGFIAFLSIMAYISI FT SLGFINLLPIPMLDGGHLMFYAFEKFLGRPLTQKTQEGFFRIGLFLLLSLMFFTTFNDL FT " XX CO join(AACY024077672.1:1..844) // ID EP498559; SV 1; linear; genomic DNA; CON; ENV; 885 BP. XX AC EP498559; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550196 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-885 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-885 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-885 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-885 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 08ed35453443fe81e6199a60c82dcd12. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..885 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077673.1:1..885) // ID EP498560; SV 1; linear; genomic DNA; CON; ENV; 870 BP. XX AC EP498560; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550198 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-870 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-870 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-870 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-870 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0917549857800b4b6b383cb0753de308. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..870 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..227 FT /locus_tag="GOS_264139" FT CDS <1..227 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264139" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685595794; CAM_CL_11961289" FT /protein_id="EBB25496.1" FT /translation="MEKLNERHAKEAEEAELKRLQEVKEQTEWLESFMSDKQDKKPQEE FT GAKKKKKKKKSHQVRKMEAAKARKKAGKR" XX CO join(AACY024077674.1:1..870) // ID EP498561; SV 1; linear; genomic DNA; CON; ENV; 949 BP. XX AC EP498561; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550200 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-949 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-949 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-949 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-949 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 2418547b257429ec9653d9886e4d0fa8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..949 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..730 FT /locus_tag="GOS_264140" FT CDS <1..730 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264140" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685605478; CAM_CL_266" FT /protein_id="EBB25494.1" FT /translation="DQFIDELIEAESYALMLDLRDEIEDLLLNGLSVEEIADAVNQQLI FT ATKPTGYNNFNNYDSISVKDFLYGIDFSSDFAEILELDNEIIVASVSEVIEPSVLPFDN FT VTDEVFDRLREDQANIEVMDLERSLIIAMDDESYVLENNNVLKDSFISVKRGSTLFPSD FT VLNNIFSSKVNSVNTQKTFNSDIYIFKVKKITEPSEDFINTIMSEYEDFSSTTSLVKLN FT LILEKEINKEIRDNIKNLNI" FT gene 731..>949 FT /locus_tag="GOS_264141" FT CDS 731..>949 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264141" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685605480; CAM_CL_423" FT /protein_id="EBB25495.1" FT /translation="MNMKKIISIFLVAILYGCGSSVSPVDQGLIDQVMHIGNGSEPQGL FT DPHIVTGVPEHHLLITMCESLTISNPEG" XX CO join(AACY024077675.1:1..949) // ID EP498562; SV 1; linear; genomic DNA; CON; ENV; 743 BP. XX AC EP498562; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550203 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-743 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-743 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-743 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-743 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c8cbd319724cc17a73f728f2e1a23dd1. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..743 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077676.1:1..743) // ID EP498563; SV 1; linear; genomic DNA; CON; ENV; 861 BP. XX AC EP498563; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550205 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-861 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-861 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-861 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-861 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; d0a00820ee82ecab84693d218c09c429. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..861 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..435) FT /locus_tag="GOS_264142" FT CDS complement(<1..435) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264142" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686255738; CAM_CL_1230" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00450" FT /protein_id="EBB25492.1" FT /translation="MNYNNNDIIIAQSTPVGSSAIAVIRVSGLSLAGLLPVLFKNKKIK FT PRYSYTLQFVGFESKVLIDTCVIVYYKAPSSFTGEDMLEISCHGNSLIIEKIINEFIAK FT GIRVAYPGEFSYRAFQNNKIDLMQAESIAEKITLNSNTYGV" FT gene complement(446..>861) FT /locus_tag="GOS_264143" FT CDS complement(446..>861) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264143" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686255740; CAM_CL_511" FT /inference="protein motif:Pfam (release 17):PF02096.9" FT /protein_id="EBB25493.1" FT /translation="GGCLPILVQMPLLIALFQVFRKTIEFRGASFLPFWITDLSQPDVI FT IYLPFLKEIWGINYFFGHGIALLPIIMGIVMFLNMKMTTTNNINPSQASTMYIMNGFFI FT LLFNTFPSGLNLYYTVYNILNFLQQKKLQKISS" XX CO join(AACY024077677.1:1..861) // ID EP498564; SV 1; linear; genomic DNA; CON; ENV; 905 BP. XX AC EP498564; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550207 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-905 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-905 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-905 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-905 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0645b56c9a600afd0f828e266c2661c6. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..905 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>905) FT /locus_tag="GOS_264144" FT CDS complement(<6..>905) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264144" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685705832; CAM_CL_661" FT /inference="protein motif:Pfam (release 17):PF00245.9" FT /protein_id="EBB25491.1" FT /translation="KFNPLEYDNEIPKSIIFIIADGTGLSQYTLSYYTDPNFFIDKFNY FT IGLVTTHPNDNKKKVTDSASSGTALATGKKTYNGAISVNHDKQPIKTIIEWAIEKEMST FT GLIATSSITHATPASFATHVNSRRLENEIAHQMAISNINVLFGGGKKYWSDNAIEKFVS FT NNGFFIENIDTPLPKNKNILGLFNYDALPTANKRIITSTKMTKIALDILDKNNNGFFLM FT VEESQIDWGGHSNDGITIKNEMKSLNELVKFCINYQMNNPSTLVLLTSDHECGGLAIDD FT SENNHLKSSFTTKLHTASM" XX CO join(AACY024077678.1:1..905) // ID EP498565; SV 1; linear; genomic DNA; CON; ENV; 872 BP. XX AC EP498565; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550209 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-872 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-872 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-872 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-872 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 08149d240c07e5b6764545740c3c5ba7. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..872 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..375) FT /locus_tag="GOS_264145" FT CDS complement(<1..375) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264145" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685654434; CAM_CL_817" FT /inference="protein motif:Pfam (release 17):PF05378.1" FT /protein_id="EBB25489.1" FT /translation="MSHPNESKERPDAPLHVKPNKTKTTKMSLVIGLDTGGTFTDAALF FT DADHGFVRTTAKALTTREDLSIGLDVAIEKVLAAYDGTPDDIQLVSLSTTLATNAVVEG FT VGGRVGLLMIGFDNGVLERAD" FT gene complement(359..>872) FT /locus_tag="GOS_264146" FT CDS complement(359..>872) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264146" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685654432; CAM_CL_7299" FT /inference="protein motif:Pfam (release 17):PF00117.14" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00888" FT /protein_id="EBB25490.1" FT /translation="ISQLTDLIQKIHQAKKPLFGVCFGHQIIAHALGGKAQKWHKGWVL FT GTKEVSLTKLPDWVEEKDWIDAKENTINLIHVHQDQVTKLPRGATLIGTANPCKNAAFI FT IGDTVFAVQGHPEFDASYTDALVGLLVDRAGKSAVKAARKSLSTSHDGMRIANWILAFF FT LRHKPPQ" XX CO join(AACY024077679.1:1..872) // ID EP498566; SV 1; linear; genomic DNA; CON; ENV; 961 BP. XX AC EP498566; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550211 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-961 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-961 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-961 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-961 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0fa13b19c81dead1c70aa24bf1f041c3. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..961 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>961) FT /locus_tag="GOS_264148" FT CDS complement(<6..>961) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264148" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685965252; CAM_CL_13107085" FT /protein_id="EBB25488.1" FT /translation="DDVIFACHSDQALALLGPCATPAERRALGDVKYQENVVYLHTDET FT LMPRNRDAWASWNCLRGDRLGISADEAASRSVCVTYWVNLLQNLAPGTKDLFVTLNPPR FT DPAAGTVEHKVTLAHPLFNKAAIAAQRDIKSLQGKDRMWFCGAWCGYGFHEDGIKSAVD FT CVDEMLGKSSVPWSPRACDPKLSTMTKMILPMFQRACTGWLPANKRLRMILPDGSERVM FT SGKGANENAKTITMTVFNQRLFMQTILRADIGLGECYMNGDFDVDLIDFMDMICKGHPA FT ASGVDTEDCKPKMRYDPVGLITEAVNWVGAQMEMAAH" XX CO join(AACY024077680.1:1..961) // ID EP498567; SV 1; linear; genomic DNA; CON; ENV; 963 BP. XX AC EP498567; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550213 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-963 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-963 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-963 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-963 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ef161afddb789c349f0d760c0cfffeb4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..963 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 45..689 FT /locus_tag="GOS_264149" FT CDS 45..689 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264149" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686604554; CAM_CL_5400" FT /protein_id="EBB25486.1" FT /translation="MTSGSPKSDISKLVSFFKGFNCELIELDSSNLKFEPKTINKNNEK FT IESNMATTMAAINESLVRSKKSKDLVYFVEDDYIHRLDSLSEMIFAYEKFSSIFKKELF FT LLSTDYPYLYKKFDSSNILFGEKCHWRTVKESLLTFLTSKKMILKYFEKLDEISKIENN FT PFEKNLHEIYEEELCFSPMPSLSIHCTNVNSIFGLSPNIDIKKLWKENEDL" FT gene 676..>963 FT /locus_tag="GOS_264150" FT CDS 676..>963 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264150" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686604556; CAM_CL_9781" FT /protein_id="EBB25487.1" FT /translation="MRIYKIFIIIFFLYFNSVKANEYSLDKNFISLKDFLLLKFEIHLQ FT QNLPRIFKGGGVMNVKYQKINYDLKIDKNDNILIMIDAIMDKQRYTSKRYF" XX CO join(AACY024077681.1:1..963) // ID EP498568; SV 1; linear; genomic DNA; CON; ENV; 849 BP. XX AC EP498568; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550215 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-849 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-849 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-849 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-849 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 44c193a9ab5f6ec074f170b6ec05ba02. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..849 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077682.1:1..849) // ID EP498569; SV 1; linear; genomic DNA; CON; ENV; 894 BP. XX AC EP498569; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550217 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-894 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-894 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-894 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-894 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e24f546cc953e7a31281f09a5a90d8e9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..894 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077683.1:1..894) // ID EP498570; SV 1; linear; genomic DNA; CON; ENV; 935 BP. XX AC EP498570; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550219 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-935 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-935 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-935 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-935 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c79ef68a520904960839b6ca721868ca. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..935 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(171..686) FT /locus_tag="GOS_264151" FT CDS complement(171..686) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264151" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685736204; CAM_CL_11371826" FT /protein_id="EBB25483.1" FT /translation="MNSFRDIETAAKNIKWFKDIKDIANPDDPICKNWLSYTAWMTDKL FT RNEFPQHTLKVTDESFGEIPPMLRDIKKNAVGLRREIKISVVKNVSIFAQTFAPNSTLE FT KNPWIKDLGNNPLGGKLSLIKDIKRVGLLFSKVKIGDSRILCRRSSFEFNSEFIHLVEA FT FPSSLNEI" FT gene 214..537 FT /locus_tag="GOS_264152" FT CDS 214..537 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264152" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685736206; CAM_CL_13387999" FT /protein_id="EBB25484.1" FT /translation="MNSELNSKEDLLQRILLSPILTLENSRPTLLMSFIRESFPPSGLF FT PRSLIHGFFSRVEFGANVCANIDTFFTTDILISRLRPTAFFLMSLNIGGISPKDSSVTL FT RVC" FT gene complement(727..>935) FT /locus_tag="GOS_264153" FT CDS complement(727..>935) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264153" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685736210; CAM_CL_1469" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00643" FT /protein_id="EBB25485.1" FT /translation="DLELRVPGEILGIRQKGVVGLKIADISRDAYLIPKINKVCDQFEN FT DFPEESEKLVKRWIGNQINYRNV" XX CO join(AACY024077684.1:1..935) // ID EP498571; SV 1; linear; genomic DNA; CON; ENV; 843 BP. XX AC EP498571; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550222 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-843 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-843 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-843 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-843 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b2a03b75fdf6cf596c16844c9f0c3b3a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..843 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>842 FT /locus_tag="GOS_264154" FT CDS <1..>842 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264154" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685635428; CAM_CL_14284322" FT /protein_id="EBB25482.1" FT /translation="NKTIRDKNLKILKFISEETSKRGLDFQLALWTQKYDFDEVPNANY FT QIKNIPNNYAEYCRDSLKEILRKCPDISGITLRVHVECGIPEKDYKFWETYFTAIKKTK FT KLINLDLHAKGIDNKLINLALEATPNVTVSPKYIGEHMGLPYHQTSIRKQEMPPKHLVD FT KKWIFSEGKRKFLRYSYGDLLSNKRKFDILFRIWPGTQRILIWGDPDLARGYGEHSTFC FT NSLGVELCEPLSFKGRMGTGIKNGRYNYSEKKLRTKYDWQKYIYTYKVWGRCVYNYAT" XX CO join(AACY024077685.1:1..843) // ID EP498572; SV 1; linear; genomic DNA; CON; ENV; 756 BP. XX AC EP498572; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550224 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-756 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-756 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-756 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-756 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f8966a02ba32bb6f93633c5485135d29. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..756 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..530 FT /locus_tag="GOS_264155" FT CDS <1..530 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264155" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686114384; CAM_CL_7403" FT /inference="protein motif:Pfam (release 17):PF02698.6" FT /protein_id="EBB25481.1" FT /translation="TKHQSDAIVVASAGVHKSGAPTPGSTLRAHTAAKLYLEGVAPLVI FT ITGGVTEPYLHPVNIKGIAIILQGMGVPSHDIIIENRSADTHKNGIETAKILKRLNLNT FT VLLVSHDYHLYRLVSVFKKLGIESYTYAANRSYPVTANPWWRYFDWANFNRLQTIVHEY FT LGLLSYKYSNRI" XX CO join(AACY024077686.1:1..756) // ID EP498573; SV 1; linear; genomic DNA; CON; ENV; 1022 BP. XX AC EP498573; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550226 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1022 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1022 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1022 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1022 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 5e0c06a2254734e604d773ee57ff32e0. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1022 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..283) FT /locus_tag="GOS_264158" FT CDS complement(<1..283) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264158" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685885136; CAM_CL_3691" FT /protein_id="EBB25480.1" FT /translation="MITPILVTKNITFKIYLIMKIKRISAYKVDLPLHEGSYKWSEGKS FT VDVFDSTIVAVETDEGYIGYGECCPLGPFYLPAICCWCSFWNKRISASP" FT gene 343..>1022 FT /locus_tag="GOS_264156" FT CDS 343..>1022 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264156" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685885134; CAM_CL_1354" FT /inference="protein motif:Pfam (release 17):PF00701.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00674" FT /protein_id="EBB25479.1" FT /translation="MKPDWKGIYPALTTKFTDNYQLDLDTFIKNLNAQLEAGIHGCVIA FT GSLGEASTLNQDEKISLLNESVKNVDDKIPVIMNIAEQSTSDAVIAAQNAEENGADGLM FT MLPPMRYLSDDRETVEFYKSVATSCGLPIMLYNNPHDYKIEITIPMFEELLKLDTIQAT FT KESTRDVTNVTRMRNAFGDDIKILCGVDTLALEELVLGADGWVAGLVDAFPRETVVIYE FT LIKQ" XX CO join(AACY024077687.1:1..1022) // ID EP498574; SV 1; linear; genomic DNA; CON; ENV; 866 BP. XX AC EP498574; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550228 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-866 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-866 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-866 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-866 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 822ac811f9805baaf72efc22d0bae9d0. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..866 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..486) FT /locus_tag="GOS_264159" FT CDS complement(<1..486) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264159" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686124654; CAM_CL_262" FT /inference="protein motif:Pfam (release 17):PF00070.15" FT /inference="protein motif:Pfam (release 17):PF00890.13" FT /inference="protein motif:Pfam (release 17):PF01266.11" FT /inference="protein motif:Pfam (release 17):PF01946.6" FT /inference="protein motif:Pfam (release 17):PF02558.5" FT /inference="protein motif:Pfam (release 17):PF07992.1" FT /protein_id="EBB25477.1" FT /translation="MCSWISGNLTLPHSDIVIIGGGAIGLSSAYYLNQKGFDVTILDSN FT DESLYDSCSWGSSGMIVPSHIVPLAAPGVVKQGLKWLLDPKSPFSIEFKPSIEMISWLL FT KFRKAANKKHVKQAADLLRNLSMDSRSLYQDIDKNINFEFETKGILMLCKSEKSLEEE" FT gene complement(459..>866) FT /locus_tag="GOS_264165" FT CDS complement(459..>866) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264165" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686124656; CAM_CL_5616" FT /inference="protein motif:Pfam (release 17):PF05544.1" FT /protein_id="EBB25478.1" FT /translation="IRIKINENYTFLHPEDERINKCIHVLWTGEPLKENSTARNGVFYG FT EKAIDRSPCGTGTSARMAQWYSNGKLSIGDEFIHESIIGSQFIGRIEKETKVGDYNAII FT PSIEGWAKIYGFNKIIIDPEDDPYAHGFQVI" XX CO join(AACY024077688.1:1..866) // ID EP498575; SV 1; linear; genomic DNA; CON; ENV; 850 BP. XX AC EP498575; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550230 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-850 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-850 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-850 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-850 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 396a09d1b158cc3259e89e7e1f236812. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..850 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>850) FT /locus_tag="GOS_264166" FT CDS complement(<6..>850) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264166" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686044892; CAM_CL_2333" FT /protein_id="EBB25476.1" FT /translation="DEDARRRKQATLADKKNRETHARLIGAQNATLEGGKGGATADFVA FT YKSMADVPVPRNSDPVLTVDRDAETVLLPVHGQLVPFHIMAVKSVTVTQDAGHAFIRIN FT FNAPTAPGATAANATYPANVKFPDLTFLREVSYRSSDTKHANYIVQEMRALKRNVSQRE FT TEKAERATLVRQERLVLSHGRVHRLVGLWMQPTFGGRGGRKAGTLEAHTNGLRYVGAKA FT DEQVDVIYSNIKFAFFQPAKKELKTLIHFHLHDAIMIGKKKTKDVQFYMEIMEAVQSLD FT " XX CO join(AACY024077689.1:1..850) // ID EP498576; SV 1; linear; genomic DNA; CON; ENV; 900 BP. XX AC EP498576; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550232 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-900 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-900 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-900 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-900 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e065dc7c64c6d3fe248b83a63134ef67. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..900 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(111..341) FT /locus_tag="GOS_264167" FT CDS complement(111..341) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264167" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685676038; CAM_CL_13261884" FT /protein_id="EBB25474.1" FT /translation="MWSGKSLLNRDVPNVSLISNRRKQIMNKSPKRKTSVYLDEKNLET FT IKGFKKKYNLSVNRTINLCLQRYLPEMTVWI" FT gene complement(407..>900) FT /locus_tag="GOS_264168" FT CDS complement(407..>900) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264168" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685676036; CAM_CL_11702543" FT /protein_id="EBB25475.1" FT /translation="YVLTEYEISLSADNGYSPHCHLQIGTTNPMPLDEIQSLLAQDWRR FT IVAKVSPTKNVIPSYKKGVDVSDNPSGEHSKDKDPFEMESLKKLQRKSKRMIKERFRKK FT NSFSLIQMQSMISEDTSESSDFLPVLKTIYQKTLKRFRSFFLNLNQRHPLFSQVIQIQK FT " XX CO join(AACY024077690.1:1..900) // ID EP498577; SV 1; linear; genomic DNA; CON; ENV; 901 BP. XX AC EP498577; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550234 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-901 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-901 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-901 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-901 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; af0ee5c6801a03c2b68cb18b60011ab2. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..901 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>899 FT /locus_tag="GOS_264169" FT CDS <1..>899 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264169" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685953696; CAM_CL_3819" FT /inference="protein motif:Pfam (release 17):PF03781.5" FT /protein_id="EBB25473.1" FT /translation="KARDAVRIWIRQKLNCLDDHFRCGRDERGMLERVTGFQEETLETY FT RMLLVNLDKKLFPEEQTLPPVQAMDLETQCDFVQKGKTFNIKQGMVYIEGGPFSMGSEE FT GPDNEIPKREVHVDGFWIDRCEVTNYQYLLYLGRDPFLRKSTFPRKFHDGNYLKNWMDD FT LMPPMAEELNPVVYVSWYAARYYCNALGKRLPSEAEWEKVARDQTEGEYPFEGGAEFLP FT DYGWFRKNSGGLMHIAAEKTPNSYGVYDTLGNAWEWVFDRFGFYQLRNKDNPQGPKTGA FT YRVLRGGAWNDPADYLRP" XX CO join(AACY024077691.1:1..901) // ID EP498578; SV 1; linear; genomic DNA; CON; ENV; 618 BP. XX AC EP498578; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550236 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-618 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-618 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-618 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-618 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ea1394c5c3cdd14ccaf5e08aa903f28f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..618 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077692.1:1..618) // ID EP498579; SV 1; linear; genomic DNA; CON; ENV; 944 BP. XX AC EP498579; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550238 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-944 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-944 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-944 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-944 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 7cba0571054781c702bdac48c1d9ef71. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..944 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..225 FT /locus_tag="GOS_264170" FT CDS <1..225 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264170" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685545250; CAM_CL_681" FT /inference="protein motif:Pfam (release 17):PF00117.14" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01855" FT /protein_id="EBB25471.1" FT /translation="WSNIPRTSFFYFVHSYYASAESKEDISSTTTYDIDFTSSVIKDNI FT FACQFHPEKSSKYGLQMISNFINWSESLK" FT gene 204..>944 FT /locus_tag="GOS_264172" FT CDS 204..>944 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264172" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685545246; CAM_CL_1140" FT /inference="protein motif:Pfam (release 17):PF00977.10" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00007" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01919" FT /protein_id="EBB25472.1" FT /translation="MVGEFEVIVYPAIDIIDGKCVRLSRGDYSNKTIYSDNLESVVSSW FT LSKGTRFLHIVDLDGAKAGRPLNIDSILKIRKSFPDIFIQIGGGIRNIETVNQYLANGI FT NRIILGTKVLKDREFIRSIDQAHRKSLAIDIAIKDGQLAGDGWETTANNDVGDFIDYFE FT QNGIELFIVTDINQDGMMQGINSESIEKILKFISTKAIISGGVTSTNDIQSILKMTRSK FT IDGFIIGKALYENTIDLKEAINECS" XX CO join(AACY024077693.1:1..944) // ID EP498580; SV 1; linear; genomic DNA; CON; ENV; 914 BP. XX AC EP498580; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550240 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-914 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-914 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-914 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-914 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; db0def9d03b049203d0f37c576c349c9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..914 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..403) FT /locus_tag="GOS_264175" FT CDS complement(<1..403) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264175" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685534722; CAM_CL_643" FT /inference="protein motif:Pfam (release 17):PF01266.11" FT /protein_id="EBB25469.1" FT /translation="MEMKHLDVVVVGAGISGIGAAYNLQKTCPQKSFSILEGRENIGGT FT WDLFKYPGIRSDSDMHTMGFRFKPWTDPKTIADGPSIIRYLKEAVEENNLEEKIQFQKK FT VISASWNTNDALWTLEIENKSNNTTEFISC" FT gene complement(441..>914) FT /locus_tag="GOS_264176" FT CDS complement(441..>914) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264176" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685534720; CAM_CL_1197" FT /inference="protein motif:Pfam (release 17):PF02882.8" FT /protein_id="EBB25470.1" FT /translation="GVTSLGFGRMSMGEKAFGSCTPQGIMRLLDHYEIEIEGKHAVVVG FT RSPILGKPMAMMLLNANATVTICHSRTKNLEEQVSTADIIVGAVGIPKFIQGDWIKDNA FT VVIDAGYHPEKCGDIDLDQVKERSLAYTPVPGGVGPMTISTLILQTVEACENS" XX CO join(AACY024077694.1:1..914) // ID EP498581; SV 1; linear; genomic DNA; CON; ENV; 932 BP. XX AC EP498581; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550242 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-932 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-932 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-932 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-932 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 2a1671b269cf073dc049eff524320447. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..932 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 167..640 FT /locus_tag="GOS_264177" FT CDS 167..640 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264177" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686854628; CAM_CL_11090614" FT /protein_id="EBB25467.1" FT /translation="MKNYITGIITGISLTASAVMFMGSQNKNLGDITVNSIRVKKDDTY FT TTMLINNQSLRIVTEVGGISLFKELIVVSNKDNENAVVIGMNDSGGGLLEINNGKGENR FT FSFSQSNQGDGSMRINNSKGNEVVYLGSNIDNDGLIKLSDRYGDFGWGMIGKK" FT gene 616..>932 FT /locus_tag="GOS_264178" FT CDS 616..>932 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264178" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686854630; CAM_CL_11090614" FT /inference="protein motif:Pfam (release 17):PF00565.7" FT /protein_id="EBB25468.1" FT /translation="MGYDWKKMKQLWLILFTLCIGCNAQTKTEVFVGRVIDGDTFVGSP FT NYIKNETYRLIGINAPEKNEQGYARATRELQLLLYSSGCFRRVEVTTYGKDVYGRSLAY FT V" XX CO join(AACY024077695.1:1..932) // ID EP498582; SV 1; linear; genomic DNA; CON; ENV; 924 BP. XX AC EP498582; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550244 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-924 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-924 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-924 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-924 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 5be56ec6c554447d4f398d26da4d73e0. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..924 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..556 FT /locus_tag="GOS_264179" FT CDS <1..556 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264179" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686485718; CAM_CL_5833" FT /inference="protein motif:Pfam (release 17):PF00037.13" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00273" FT /protein_id="EBB25465.1" FT /translation="LDNGRTRMFEDKLLRDTLLCIRCGACMNHCPVYSRIGGHAYNSIY FT PGPIGKIITPQINDLNESGHLADASSLCGACVEVCPVKIPITNILLRLRHKKLTKKLKF FT GQINLSGWKHLKLFVFWKIWLIVFSNPKLYKLKSFFISKTISILPKWLPIISEWTLVRT FT LPKFPNKSLHILVKEKGISEE" FT gene 507..>924 FT /locus_tag="GOS_264181" FT CDS 507..>924 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264181" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686485722; CAM_CL_7978" FT /protein_id="EBB25466.1" FT /translation="MKVYIYLLKKKELVKNNYNIARKNILSRLRKFPRVPEAPPENDLV FT TLGKKYSNEIKIKKFKNAIEKSHAEVYLCSEKNMFYVFSSVIKSKKIKKIIYGEKNILR FT EKIVGEFQKNSIDIPEFVEYNQPIEEIKDLLFDAD" XX CO join(AACY024077696.1:1..924) // ID EP498583; SV 1; linear; genomic DNA; CON; ENV; 858 BP. XX AC EP498583; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550246 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-858 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-858 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-858 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-858 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 7a260c173bbaa0ff8881c1119f91659c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..858 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(18..281) FT /locus_tag="GOS_264183" FT CDS complement(18..281) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264183" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686145034; CAM_CL_11211751" FT /protein_id="EBB25464.1" FT /translation="MPFNLASVYKAFSSSSVYSLPSEMSTFSKASSHSWNSFSKSGFCI FT LNAFYNSFCLLINLKHYVDINYHYFLYIKLFAFNKTYCNISI" FT gene 148..>858 FT /locus_tag="GOS_264182" FT CDS 148..>858 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264182" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686145032; CAM_CL_2325" FT /protein_id="EBB25463.1" FT /translation="MQNPDFEKEFQEWLEALENVLISDGKEYTEELLKALYTEARLKGI FT EVSELNDPPFKNTVHSDEEHPYPGNLEYEEKIRHFIRWNSLLTVLKANKESDLGGHIST FT YSSAATLYEVGFNHFFRGSDKSLGDLIYFQGHSSPGIYARSFLEGRITSSQLDNFRQEI FT KGEGLSSYPHPWLMPDYWQFPTVSMGLGPIFGIFQAHVMRYLEKRGLIKSIENRKVWVF FT CGDGEMDEPESMGSI" XX CO join(AACY024077697.1:1..858) // ID EP498584; SV 1; linear; genomic DNA; CON; ENV; 858 BP. XX AC EP498584; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550248 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-858 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-858 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-858 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-858 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 613dcb5614a2d004cae7b1a720707d03. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..858 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 281..>858 FT /locus_tag="GOS_264184" FT CDS 281..>858 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264184" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685874948; CAM_CL_2233" FT /inference="protein motif:Pfam (release 17):PF02190.6" FT /protein_id="EBB25462.1" FT /translation="MMPGEVQNKSNAVKKLALPMLPMRDIVVFPHMTAPFFIGRTLSIA FT SLEKALAGDRQIFVVAQEDPLVEEPEEKDLFRVGTIGQVLQIMRLHNGTIKALFEAKTR FT GRLIEAHMEDPHFAAVVEPIPENVSKGPELIALSKNVSTEFKRYLKDVKHRTEGIEKLS FT LDSDDPHIIADRIAPLLNMELIRKQELLE" XX CO join(AACY024077698.1:1..858) // ID EP498585; SV 1; linear; genomic DNA; CON; ENV; 926 BP. XX AC EP498585; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550250 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-926 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-926 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-926 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-926 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 33aa709c1e53c46cf90818ee15a35936. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..926 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>926 FT /locus_tag="GOS_264185" FT CDS <1..>926 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264185" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685864918; CAM_CL_3065" FT /inference="protein motif:Pfam (release 17):PF00072.10" FT /inference="protein motif:Pfam (release 17):PF00158.15" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01817" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01818" FT /protein_id="EBB25461.1" FT /translation="GMNGLDLLSTIQESHPSLPVIIMTAHSDLDSAVASYSRGAFEYLP FT KPFDIEDAIAITQRALDHNNDTERDSTKSVSKSHPEIIGEAPAMQEVFRAIGRLSNSNI FT SVLINGESGTGKELVAHALHKHSPRKDMQFVPLNVAAIPKELIESELFGHEKGAFTGAT FT QQRTGRFEQANGGTLFLDEIGDMPPDTQTRLLRVLSDGEFYRVGGHTSIKVDVRIIAAT FT HQNLEDLVTKNSFREDLFHRLNVIRIHIPRLCERREDISQLVEHFLKVAAKELEVEPKI FT LRPETEKYLAGLEWPGNVRQLENFCGW" XX CO join(AACY024077699.1:1..926) // ID EP498586; SV 1; linear; genomic DNA; CON; ENV; 953 BP. XX AC EP498586; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550252 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-953 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-953 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-953 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-953 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0be36c82b593496871e342f0abf1979e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..953 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077700.1:1..953) // ID EP498587; SV 1; linear; genomic DNA; CON; ENV; 897 BP. XX AC EP498587; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550254 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-897 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-897 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-897 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-897 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b3baadd3bb8904efa990e5d39073352d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..897 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>896 FT /locus_tag="GOS_264189" FT CDS <1..>896 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264189" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685984862; CAM_CL_1246" FT /inference="protein motif:Pfam (release 17):PF00478.12" FT /inference="protein motif:Pfam (release 17):PF00571.16" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01302" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01303" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01304" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01305" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01306" FT /protein_id="EBB25460.1" FT /translation="NVSAEEILQTHKIEKLPVVDSKGILIGLITFRDINKHSEKPTSNK FT DKLGRLMVSAAIGTDKDYKKRAQKLIKSGVDALVVDTAHAHSSKVGEVLKNLKDSFSEV FT DIVVGNIATADAANYLKENGADGIKVGIGPGSICTTRVVAGVGYPQLSAVLEVSEVLKN FT SKIPLIADGGIRYTGDISKAIAAGADSVMLGSLLAGTEESPGETIIYDGRKFKTYRGMG FT SVEAMQKGSRDRYFQSEQADKKKLVPEGIVGRVPYKGQLNESIHQFIGGLRSGMGYCGA FT KDIASLKKSSNLLRYWF" XX CO join(AACY024077701.1:1..897) // ID EP498588; SV 1; linear; genomic DNA; CON; ENV; 984 BP. XX AC EP498588; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550256 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-984 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-984 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-984 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-984 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c68a873cc8eba10a73d03ac323723242. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..984 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..276) FT /locus_tag="GOS_264196" FT CDS complement(<1..276) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264196" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685835276; CAM_CL_13038583" FT /protein_id="EBB25458.1" FT /translation="MEKTLLYHYTSLSHLIEIFKTGKVLTSQTEKMLKVKKPGLWFSTN FT SKWEYSAFKRFNDGKKEFDLNTPEEFEKYIGCARLVTNLNSLFVTLL" FT gene 324..980 FT /locus_tag="GOS_264197" FT CDS 324..980 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264197" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685835274; CAM_CL_924" FT /inference="protein motif:Pfam (release 17):PF00494.8" FT /protein_id="EBB25459.1" FT /translation="MKSIFDEVSNDCSRLVIKRYSTSFYFSSNLLSKSIRQDIFNIYGF FT VRLADEIVDTFHEFPKKELLEEFEKELWRSIDNRISLNPILNSFQYTVNKYSIPADLIR FT SFLDSMKMDLEKKEYDTVEEYKKYIYGSADVVGLMCLRVFVNGSENLYNELSPYAISLG FT SAFQKVNFLRDIKDDSNILNRVYFPNVDMDNFNEYSKKENIEENEEDLKMQSKES" XX CO join(AACY024077702.1:1..984) // ID EP498589; SV 1; linear; genomic DNA; CON; ENV; 930 BP. XX AC EP498589; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550258 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-930 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-930 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-930 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-930 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 76217263a22f80fc6d48fe75a0dc86f9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..930 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..240 FT /locus_tag="GOS_264198" FT CDS <1..240 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264198" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686785636; CAM_CL_49" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01829" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01830" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01831" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01832" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01963" FT /protein_id="EBB25455.1" FT /translation="AKEFATRNITANVIAPGPVKTNMIDELTEQQRENILAAVPLGRFA FT EPEEIAATVAFLASDQAGFITGAIIPVDGGIGMN" FT gene 279..515 FT /locus_tag="GOS_264203" FT CDS 279..515 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264203" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686785638; CAM_CL_14604" FT /inference="protein motif:Pfam (release 17):PF00550.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00517" FT /protein_id="EBB25456.1" FT /translation="MSEENFERFRKCAVEVLSVEAGQVTKEARFAEDLDADSLDLVELV FT MELEEEFDITVDEEELQELPTVGDAFNLISSKL" FT gene 515..>930 FT /locus_tag="GOS_264205" FT CDS 515..>930 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264205" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686785634; CAM_CL_897" FT /inference="protein motif:Pfam (release 17):PF00109.14" FT /protein_id="EBB25457.1" FT /translation="MRNRVAVTGVGVVANVGQGSSAFWSGLLSGVPSHGFELHDFDPLP FT YFDGNAKEARRCDRFAQLAFAAADEAITQAGDFIRDPTRCGSWVGTGVGGLDTLEKQVQ FT VLSEKGPRRVSPFLIPMLMANAASAGISMKYGLQG" XX CO join(AACY024077703.1:1..930) // ID EP498590; SV 1; linear; genomic DNA; CON; ENV; 960 BP. XX AC EP498590; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550261 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-960 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-960 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-960 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-960 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 37c0c9249a80d73e87c764fc8002b25f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..960 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>959 FT /locus_tag="GOS_264206" FT CDS <1..>959 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264206" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686374662; CAM_CL_897" FT /inference="protein motif:Pfam (release 17):PF00108.11" FT /inference="protein motif:Pfam (release 17):PF00109.14" FT /inference="protein motif:Pfam (release 17):PF02801.10" FT /protein_id="EBB25454.1" FT /translation="LEDQHKVISEKGARRVSPQFVPKMISNIAGGHLAMRWNLKGPNQT FT ITSACASATDAIGIAMRLILAGDADAMITGGTEASVTALTIAGFANMRALSQLNDNPQA FT ASRPFEKHRDGFVLGEGSGILVIETESHAKSRGAIILAELAGYGSTDDAFHITQPSEGG FT IGAVKAMNRAITDSGLNINQIDYINAHGTSTPFNDKTESAAIERLFSEHCKKIKVSSTK FT SMTGHLLGAAGGIEAVASVKTIMEQTIPPTINYDTPDPDCNLDYVPNFAQDFNVSALLS FT NTFGFGGHNAVLCMKKYNLKLFAKLKQFFLDRSNSVSN" XX CO join(AACY024077704.1:1..960) // ID EP498591; SV 1; linear; genomic DNA; CON; ENV; 967 BP. XX AC EP498591; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550263 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-967 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-967 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-967 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-967 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 03cafeb59853fbe2e1a270ebadd9033f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..967 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(11..898) FT /locus_tag="GOS_264209" FT CDS complement(11..898) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264209" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685846150; CAM_CL_13127557" FT /protein_id="EBB25453.1" FT /translation="MKRSYEKSSDGQILRRQKAILNGNKITTEIWNYGSISSPGNRVTD FT IIWEGLGYGYEFGPMICAEVPILSKSHEDAFPKISTNNDTTWYVNAISDGLVSLGGEVS FT PDGQEFWTWEPLAYNDNNVPYADSNSDFLPTSTDVDRDGDGKPDSWPEGWYNQNTKSYE FT WPGALRQGSSNSDMESFFVVDDRMNREFEYYPFPSDSTRRGLGLEIEMRYYQWSNPLAE FT DIIFLIYKVTNVSEKDLEKVTFGMWGDPHIGGPYNWQDDLSFFDKENNIVYAWDADGIS FT DVSGRAPGYFGYKF" XX CO join(AACY024077705.1:1..967) // ID EP498592; SV 1; linear; genomic DNA; CON; ENV; 899 BP. XX AC EP498592; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550265 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-899 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-899 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-899 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-899 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8617a3ed6d8c043cefc80e567e3a5882. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..899 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 41..>899 FT /locus_tag="GOS_264210" FT CDS 41..>899 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264210" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685505254; CAM_CL_12041128" FT /inference="protein motif:Pfam (release 17):PF00487.13" FT /protein_id="EBB25452.1" FT /translation="MVSVLFHAAASYYSIENLLLNYLIYASIVGVFAVVMAVVAHKTEG FT LGPVIGGFFSVKSAKVQDAMTLVEDSVDALVADQAGAKANGLSASKTASNDAYTTSVSA FT DIVAANTTRVDASAGAKAAKVAAQTKGAQAAPQSIDAEDIVFLKGLLKKHKANNVDAWA FT YLATSFVLWCGGMYCMHFHTAWWSVLFVGGVNVRLFIIFHDACHNSFFPSSKRNHVLAS FT FLQAIVGQNMSDWTKSHNHHHRHLGRVDISDFSLTVWFTEAEYHSMTPVLKFAYRLIRD FT PLVLP" XX CO join(AACY024077706.1:1..899) // ID EP498593; SV 1; linear; genomic DNA; CON; ENV; 867 BP. XX AC EP498593; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550267 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-867 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-867 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-867 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-867 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9e7bcdf44e031360b0436e41395fd289. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..867 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>867) FT /locus_tag="GOS_264211" FT CDS complement(<5..>867) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264211" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685645016; CAM_CL_2693" FT /inference="protein motif:Pfam (release 17):PF00443.16" FT /inference="protein motif:Pfam (release 17):PF00627.17" FT /protein_id="EBB25451.1" FT /translation="SLEFRKGMATETTRFADFPAYLWVHMARYTLDPNTYQTLKLKHTV FT TPPLELDLSALKGSGMQAGEAPLEEEEEEDASASSAEGPQPDASIVQAIVGMGFSENAG FT KRAALATSNAGAEAATNWLFGHMEDADLNDPLPSGGSSSSGGGGGGADPAAVAQLCSMG FT MTSDQAKFALKQPGNEDPNNAVMWFFSNQERLPALMAAAAEAEAKASGGAAAFEAAAEA FT DAKARASRVGKFELVGFISHVGKNTGSGHYVCHIRKVIPGQEEKGLQWVIHNDRKVALS FT QNPPRA" XX CO join(AACY024077707.1:1..867) // ID EP498594; SV 1; linear; genomic DNA; CON; ENV; 860 BP. XX AC EP498594; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550269 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-860 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-860 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-860 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-860 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9f6b1790f2b7c0c89df8afae9bf9216a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..860 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(214..>860) FT /locus_tag="GOS_264213" FT CDS complement(214..>860) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264213" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686175110; CAM_CL_5143" FT /inference="protein motif:Pfam (release 17):PF04079.5" FT /protein_id="EBB25450.1" FT /translation="LSEGEKEVEAILFAAAEPLDIDTIESKVPKKINVLNILNKLQKIY FT QNRGINLICISNKWSFRTSQSLSGLMSEQKTVEKKLSKAAIETLSIIVYHQPVTRAEIE FT EIRGVAFGTNTLEILMELNWVRTQGRKEVPGKPIQYGTTEEFLSHFNLQKLSDLPTIDE FT LGTAGLIDAANVDSTIFGTGKFYKEQEEKKENIYSDIDEMLNSTLKNDDDK" XX CO join(AACY024077708.1:1..860) // ID EP498595; SV 1; linear; genomic DNA; CON; ENV; 950 BP. XX AC EP498595; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550271 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-950 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-950 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-950 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-950 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b3aba267b75cb525a1a27a9215c01ef7. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..950 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(62..715) FT /locus_tag="GOS_264214" FT CDS complement(62..715) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264214" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686184312; CAM_CL_279" FT /inference="protein motif:Pfam (release 17):PF00702.12" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01993" FT /protein_id="EBB25449.1" FT /translation="MKNLVEIDCWIFDLDNTLYPASVDLFSQINVNMSNYIMNLLDVDK FT IAADKMRAEYWKKYGTSLAGLMQNHKIDPDDFLSIVHDIDFSVLSKDLNLLDALNNLPG FT KKLIYTNGTVPYAREVLKYRGLLDVFDEIYGIEDATYVPKPFPKAFEIIFSKANIAHNR FT SAMFEDEVRNLEVPFKLGLKTILVSDVQSNKKYVDYTINCLSDFLRQITSNSFK" XX CO join(AACY024077709.1:1..950) // ID EP498596; SV 1; linear; genomic DNA; CON; ENV; 899 BP. XX AC EP498596; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550273 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-899 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-899 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-899 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-899 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ae2f25cad330346eb9b74a7168893e36. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..899 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>897 FT /locus_tag="GOS_264216" FT CDS <1..>897 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264216" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685795518; CAM_CL_1132" FT /inference="protein motif:Pfam (release 17):PF00115.8" FT /protein_id="EBB25448.1" FT /translation="AITMLLTDRNFGTTFFDPAGGGDPILYQHILWFFGHPEVYIIILP FT GFGIISHVIATFSRKPVFGYLPMVWALIAIGALGFVVWAHHMYTVGMSLTQQSYFMLAT FT MVIAVPTGIKIFSWIATMWGGSIEFKTPMLWAFGFLFLFTLGGVTGIVLAQAGVDRAYH FT DTYYVVAHFHYVMSLGAVFAIFAGIYFYFPKMTGRIIPEWAGQLHFWTMFVGSNITFFP FT QHFLGRQGMPRRYIDYPEAFALWNQVSSYGAFLSFASFVFFFIVIIYAIVAGKKETRAN FT PWNEYADTLEWTLPSPPP" XX CO join(AACY024077710.1:1..899) // ID EP498597; SV 1; linear; genomic DNA; CON; ENV; 980 BP. XX AC EP498597; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550275 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-980 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-980 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-980 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-980 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ff824b61a94ff014ffff677bf652e441. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..980 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 468..>980 FT /locus_tag="GOS_264217" FT CDS 468..>980 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264217" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685496970; CAM_CL_4150" FT /protein_id="EBB25447.1" FT /translation="MLSTTLFTIGPYDICLWNIIIISLIIIGTYLLRKFIYKTLNKHLS FT EAFFEIEGRKIAWLRLLGQSTYLMAIYIAVMSLNYNNHHVRFSDFLDIKIITIGEFHLN FT FYHIVSILCVLLVSKIITNIVKLYIKRSFRLAEEYNRGSEFVYVQITKYIVYVFTILIV FT FQILNINL" XX CO join(AACY024077711.1:1..980) // ID EP498598; SV 1; linear; genomic DNA; CON; ENV; 924 BP. XX AC EP498598; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550277 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-924 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-924 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-924 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-924 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b57f53b87060be0863369e83f8845347. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..924 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(26..286) FT /locus_tag="GOS_264218" FT CDS complement(26..286) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264218" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686165002; CAM_CL_6801" FT /protein_id="EBB25445.1" FT /translation="MGFLDNTSITVDAILTKKGRELLARGDGSFNITKFALSDDEVDYN FT LWDTAHPNGSNYYGAVIENTPILEAFTDQNQVMRYKINNIE" FT gene complement(356..>924) FT /locus_tag="GOS_264219" FT CDS complement(356..>924) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264219" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686165000; CAM_CL_11051004" FT /protein_id="EBB25446.1" FT /translation="GTLAMPSRYSLNVTQSTEWGTNYVDASITDGDIKFEEVVNPVITA FT SRLSEHNFEYRYYFDSAFSASLHPTFGVNPIHIGALSGSTLTYQRYRLGHRAFIGHYSH FT SFERSEIQSVAYDSTLFRSFYQATSHGADKNDPNYPAVEITLTNPTRLVTVEPGESRLV FT DDTKANPRTTDFFKDSKSGEKENLD" XX CO join(AACY024077712.1:1..924) // ID EP498599; SV 1; linear; genomic DNA; CON; ENV; 932 BP. XX AC EP498599; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550279 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-932 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-932 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-932 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-932 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f2915a6a5a117d4ed0878578cf232d71. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..932 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>932) FT /locus_tag="GOS_264220" FT CDS complement(<6..>932) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264220" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096685716412; CAM_CL_11059486" FT /protein_id="EBB25444.1" FT /translation="DTLTHKLRGYLADDTTGMSTANAASGVAYKNNNFDAWRDSVMTIA FT VTLDDKGASVTAFRLDLVFDNDLITWGHDSTRVEKGAYINGWTEGDSSAGAHYSYEVVR FT YADVGYTDSLTTAGSEKSVSAARYDWLRITMVSHNGNVKTFGNGNNTQTELLKLHFKIN FT DVVDNFSPQSFRVATKYEGSTGYYTYLTNGNYASNYKVYIDGNVGTQTNGVGNARGDIT FT LHPKLLDVEGYFRYVQGKGRAVGSAFTTATENTYPYWKVKFELWERANGKSNWYNIQSI FT ANDASKTDEDLSDDVIGGAGTYYYDKKS" XX CO join(AACY024077713.1:1..932) // ID EP498600; SV 1; linear; genomic DNA; CON; ENV; 949 BP. XX AC EP498600; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550283 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-949 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-949 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-949 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-949 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 5524724cc4a62fc25a2363bdaeb0d346. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..949 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..333 FT /locus_tag="GOS_264221" FT CDS <1..333 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264221" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686465278; CAM_CL_3291" FT /inference="protein motif:Pfam (release 17):PF00306.13" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01039" FT /protein_id="EBB25442.1" FT /translation="YAVARRVQEILQRYKEFQDIIAILGLDELSEEDRVTVDRARKVER FT FLSQPMFVAEIFTGQPGVFTGIEDTISSFEALVQGDLDHVPEQAFYMVGGAEEVERKAA FT ELEASS" FT gene 340..759 FT /locus_tag="GOS_264223" FT CDS 340..759 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264223" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686465276; CAM_CL_10" FT /inference="protein motif:Pfam (release 17):PF02823.5" FT /protein_id="EBB25443.1" FT /translation="MVLPAQGDHMTLRVELVSPERVVYEGEAELVIARTTDGEIGFQPG FT HVPFVGNLVSSVIRIALSDGGVQRIAVHSGFVEVSDNHVALLSDIAELAEDIDTDRAKN FT ALDRANELLAGDSANEEAAKALQRAEVRLLAADGA" XX CO join(AACY024077714.1:1..949) // ID EP498601; SV 1; linear; genomic DNA; CON; ENV; 939 BP. XX AC EP498601; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550287 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-939 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-939 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-939 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-939 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 5a3e3454f0be8e04f312f71d26e1e548. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..939 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 84..911 FT /locus_tag="GOS_264224" FT CDS 84..911 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264224" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686416400; CAM_CL_1470" FT /inference="protein motif:Pfam (release 17):PF00750.9" FT /inference="protein motif:Pfam (release 17):PF03485.6" FT /protein_id="EBB25441.1" FT /translation="MIKMNIFEEYKNKLIIIIKKAKEDKLLILPENLDAVNVDSTPPKI FT DFDISTNVAMVLAKPNNKTPNDLAQILIKLLKNEDKSIEEISFAKPGFINIKFNKDYWN FT NFTNNLINSPYSYGASNKENKKYLVEFVSANPTGPLHVGHCRGAILGDVISNILEFNQN FT TVEREYYVNDYGNQIFHFNHSVYLRIREKLYDEKFPLDNPDLYPGDYLKDIANNIIKNN FT KDTNFENFKDIENHLKKLSINESLNLIKKNLNDLGIRHDNFISETTLVNDNEV" XX CO join(AACY024077715.1:1..939) // ID EP498602; SV 1; linear; genomic DNA; CON; ENV; 899 BP. XX AC EP498602; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550290 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-899 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-899 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-899 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-899 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 83c0938468af610a6320f42ab254751d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..899 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..230 FT /locus_tag="GOS_264226" FT CDS <1..230 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264226" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686974654; CAM_CL_6401" FT /protein_id="EBB25439.1" FT /translation="NQSKGANKQGANRFQRANNFFISSSDVAKKHNLEFNWDYKIIKGV FT GHSNTKMALAAAEVLLADTTYDKQSFRKNN" FT gene complement(214..819) FT /locus_tag="GOS_264227" FT CDS complement(214..819) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264227" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686974652; CAM_CL_1720" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01783" FT /protein_id="EBB25440.1" FT /translation="MRGSVAAFSIAYDARQIEYQIEDPNGGGIVEGIVNLGDSDQFGFE FT ADFAVRVSDYLNVSFSAGWVDAEWKSGTEVGGVDLGGQTPPVVPKSGVNLTADYLKPTN FT NGNNMAASFQISHTGSYEGLQAWDPVTNPSHTLVNAQIGQTSEDWEVMLNVENLFDEDY FT YMDVQHFPNYYLLDGGDSIVIGTLGQPRLVTLSFSYFF" XX CO join(AACY024077716.1:1..899) // ID EP498603; SV 1; linear; genomic DNA; CON; ENV; 951 BP. XX AC EP498603; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550293 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-951 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-951 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-951 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-951 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8d512152e09a08cd1570db1341f0e5e2. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..951 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077717.1:1..951) // ID EP498604; SV 1; linear; genomic DNA; CON; ENV; 861 BP. XX AC EP498604; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550296 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-861 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-861 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-861 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-861 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 337dadfbe791d1a66b69aa1d9a468c63. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..861 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..336 FT /locus_tag="GOS_264228" FT CDS <1..336 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264228" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686096110; CAM_CL_7922" FT /inference="protein motif:Pfam (release 17):PF01613.7" FT /protein_id="EBB25438.1" FT /translation="NSSCKSSHQENNGMALAAKFVQPTDSTKIKGRQGDGPAQKMNKLD FT GIDYWLSDTAVGCPILEDALVYIECVAEQFVETGDHVLVIGKIIGGEPLNSGEPLTSTY FT TGWNYSG" XX CO join(AACY024077718.1:1..861) // ID EP498605; SV 1; linear; genomic DNA; CON; ENV; 916 BP. XX AC EP498605; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550298 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-916 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-916 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-916 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-916 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 72cbbdde57ab81b00a48e6452978f82a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..916 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 615..>916 FT /locus_tag="GOS_264229" FT CDS 615..>916 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264229" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686505332; CAM_CL_4747" FT /inference="protein motif:Pfam (release 17):PF03453.6" FT /protein_id="EBB25437.1" FT /translation="MMLNYEDARDLVFQNVTPLEKCTLPLTESQGLALSDDILAPHGMP FT SFDNSGVDGYAVQAKDLAEASVVNPIMLENLGYVAAGDFGKEKMHSGQCMQIATGA" XX CO join(AACY024077719.1:1..916) // ID EP498606; SV 1; linear; genomic DNA; CON; ENV; 860 BP. XX AC EP498606; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550300 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-860 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-860 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-860 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-860 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a7f4f52e6c01c403521981b110a78b6e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..860 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(168..647) FT /locus_tag="GOS_264230" FT CDS complement(168..647) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264230" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686895166; CAM_CL_1183" FT /inference="protein motif:Pfam (release 17):PF01272.8" FT /inference="protein motif:Pfam (release 17):PF03449.4" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01461" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01462" FT /protein_id="EBB25436.1" FT /translation="MKESYPVTKKGYGLLKKELKQLLKTDRPAVVNAISSAREHGDLKE FT NAEYHAAKEQQGFIEGRIQELNAKLANVNVIDIEKLSGDKVVFGATVTFEDIDTEEVSN FT YQIVGEDESDIKQYKISISSPIARALIGRSAGETLTIPIPKGKIEIEIIKVEFIT" XX CO join(AACY024077720.1:1..860) // ID EP498607; SV 1; linear; genomic DNA; CON; ENV; 814 BP. XX AC EP498607; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550302 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-814 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-814 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-814 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-814 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e13a450885ec8943db7d6f9e3bfa60d7. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..814 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>814) FT /locus_tag="GOS_264234" FT CDS complement(<5..>814) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264234" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686495388; CAM_CL_16" FT /inference="protein motif:Pfam (release 17):PF00009.13" FT /inference="protein motif:Pfam (release 17):PF03144.12" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00484" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00490" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00503" FT /protein_id="EBB25435.1" FT /translation="LAFVNKLDRMGANPHNGIKGICDILKLNAVAMQLPIGLEEDHAGV FT IDLIRMKANYFDGEHGDDVRIEEIPANMKEDAERYRSEMLEAVSMFDDKMMEDLLEDNE FT IEEDTIHAAIKIGVQSLELCPVYMGSAFKNKGVQLLLDAVTQYLPSPLESVSTKAKDIK FT TQEDVVMSCDPEKPTVAMAFKLTEEQFGQLTYTRIYQGKLRKGEQVINSRTGNKMRIGR FT MVRMHSNDRENIDVAEAGDIVAMVGVDCASGDTFCGDGIHVSCESIFV" XX CO join(AACY024077721.1:1..814) // ID EP498608; SV 1; linear; genomic DNA; CON; ENV; 847 BP. XX AC EP498608; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550304 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-847 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-847 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-847 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-847 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 769ed33cd3b993ff135b134118dc0bd5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..847 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>847) FT /locus_tag="GOS_264239" FT CDS complement(<5..>847) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264239" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686335552; CAM_CL_3264" FT /inference="protein motif:Pfam (release 17):PF06213.2" FT /protein_id="EBB25434.1" FT /translation="GNDIIYARGEADSQAMYIRYHNKSIDQKYAPKGDMALNLFNEMEK FT ARCEAVGGSIYPGAAKNIENKIEKESKRFFEKSEPTQKFPLQDSIRILIKKKTLDYKLS FT ENSQKGLNMWEDFILNESKNNFSKILLSIDNQEEFAKLSRNIIKDLGYGDQLGEEPEND FT DNTDNDNQNDESNNSENSDENDNEQQQLPDEVEELVSDSSATDDLSVEEEINEVEQQED FT TNEEQNNRKKTNSFFSEADPNYKVFNNIYDEEVLAENLAGEEELTKLRVYLEQQLDQVK FT " XX CO join(AACY024077722.1:1..847) // ID EP498609; SV 1; linear; genomic DNA; CON; ENV; 869 BP. XX AC EP498609; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550306 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-869 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-869 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-869 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-869 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9ed5ba5c6da90b2e902d43d5b8919a00. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..869 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>869 FT /locus_tag="GOS_264240" FT CDS <1..>869 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264240" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686664764; CAM_CL_1832" FT /inference="protein motif:Pfam (release 17):PF01162.9" FT /inference="protein motif:Pfam (release 17):PF02934.5" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00133" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00134" FT /protein_id="EBB25433.1" FT /translation="LLPHNFGSEPNSNVSIVDAAMPGMLPVLNMFCIEQAVKTGLGLKA FT KINLYSQFDRKNYFYPDLPQGYQISQLYHPLVGEGEITINIKDKIRNIGIERIHVEQDA FT GKSIHDMDPNLSFIDLNRTGVGLMEIVSRPHIRSSEEAISYLKKLRQILQYLDTCDGNM FT QEGSLRADINVSVLRKGNYEKYLEKEDLSFLGTRCEIKNMNSMRFIQQAIDYEAKRQVG FT ILEDGGNIIQETRLYDPDAGKTKSMRSKEEAHDYRYFPCPDLPPLVIEQNWVDDIKKNL FT PELPDDKK" XX CO join(AACY024077723.1:1..869) // ID EP498610; SV 1; linear; genomic DNA; CON; ENV; 938 BP. XX AC EP498610; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550308 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-938 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-938 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-938 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-938 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c286f7a469fef72495b4bad00b552fd9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..938 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077724.1:1..938) // ID EP498611; SV 1; linear; genomic DNA; CON; ENV; 864 BP. XX AC EP498611; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550310 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-864 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-864 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-864 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-864 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 298ee6b63f3e4e2df6a50620dda162ce. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..864 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(8..>864) FT /locus_tag="GOS_264244" FT CDS complement(8..>864) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264244" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687194456; CAM_CL_4366" FT /inference="protein motif:Pfam (release 17):PF01063.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01121" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01122" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01123" FT /protein_id="EBB25432.1" FT /translation="FEGMKCYRSDKDSLILFRPDENFKRFNKSSLRMAIPEIPEKIFFD FT GLTELLRIDKDWVKKGDGNALYVRPFVFASEPSINASEAIEYTFMIICCPAKSYYGNQK FT IKVKIEEKYSRAAKGGVGYAKAAGNYAAQFYPTAIAKEEGYQQIIWTDSNNHKSIEEAG FT TMNLFFRIGDKLITSPTSDSILDGITRKSIIKLAKDLNIDVEERIITVDELLEAQDSGS FT LKEIFGTGTAVVILPIKTFGYQNNDFNLPDLDNPWSLELKKKLTDIQYDKSSEYEDWKV FT KIN" XX CO join(AACY024077725.1:1..864) // ID EP498612; SV 1; linear; genomic DNA; CON; ENV; 975 BP. XX AC EP498612; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550312 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-975 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-975 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-975 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-975 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 66471f9dee82e606af9b2bd4248f533b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..975 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 189..>975 FT /locus_tag="GOS_264248" FT CDS 189..>975 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264248" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687206088; CAM_CL_792" FT /inference="protein motif:Pfam (release 17):PF00941.9" FT /protein_id="EBB25431.1" FT /translation="MKPPPLDILTPTTIEDAVSLLSDYGMEARPLAGGQSLVPLLNFRL FT SRPEVLIDLNKIPELDYINEVGDQIEIGAMTRERSIEFSELIRDCAPLLWEATKNIAHL FT PIRSRGTIGGSLANADPAAEYPAAALALEMVFLVQSIRGERLIKSSDFFQDVLTTSLEP FT DELLTKIIIPKIPENSGAAFEEIARRHGDFAIAGVAAQITFRDKIPTAVNLAACGAGPV FT AMRLFASETIILKEGIGRDAIKAAAAAAAASVDQCLNIML" XX CO join(AACY024077726.1:1..975) // ID EP498613; SV 1; linear; genomic DNA; CON; ENV; 931 BP. XX AC EP498613; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550314 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-931 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-931 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-931 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-931 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 28d55a158d702a29bbbc0079b399e277. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..931 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..791 FT /locus_tag="GOS_264249" FT CDS <1..791 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264249" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686237174; CAM_CL_3174" FT /inference="protein motif:Pfam (release 17):PF00070.15" FT /inference="protein motif:Pfam (release 17):PF02852.10" FT /inference="protein motif:Pfam (release 17):PF07992.1" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01350" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01421" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01423" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01424" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01438" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02053" FT /protein_id="EBB25430.1" FT /translation="GSDVTLIVSRQQVLPQKDPEAAALLEQNFIDRGVQLLKGARATEV FT LRHGATVTVHCSDGRTAEGTHAVLAIGSDPNSQELGLENTEVVVDESGYIEVDHNLRSS FT VPSIYAAGDLSGKLPLSSVAAMQGRKIAEHIMGLHEGREHRHLDYDKAASAIFTEPEIA FT DVGLAEAEAFATGRKIRVTKVPFSSNAKALINNDPLGFVKIVSDPNTGHVLGGSIVGQH FT AAELISVVALAVSANLKVQDIHESLFVYPTLSEALSEAAE" XX CO join(AACY024077727.1:1..931) // ID EP498614; SV 1; linear; genomic DNA; CON; ENV; 920 BP. XX AC EP498614; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550316 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-920 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-920 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-920 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-920 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a25da7915c414433c659ad4287a408d8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..920 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..292 FT /locus_tag="GOS_264258" FT CDS <1..292 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264258" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686446582; CAM_CL_11175474" FT /protein_id="EBB25428.1" FT /translation="SRSEAVIGFCAGAVRTSCTSNRWTWSRRHTAYPRTKVATNPIPVA FT IPIAVSNSFSLNRRLRRGRSRDMISERTLGIVSAWVASAYRQRDTHFSHLT" FT gene complement(221..>920) FT /locus_tag="GOS_264259" FT CDS complement(221..>920) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264259" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686446580; CAM_CL_11806500" FT /protein_id="EBB25429.1" FT /translation="LLIAAMDKGIRNPIAVPLPFTTPASVKPPQEGVALLQDELREDLR FT AALDAAGHQVLNINDPQVGIVIDSAQSTSEIEPLRKAMSEEKVVVAMRCNPAATDTIRH FT QSDGYLISECDELLATVQELTTNNFERKRVGFEARRTIATTNWARVTRALLLNNRNGMP FT DLEQFSFLPARQRWKDRLGHAHKWHSGQYLDDGYIEFDGETVDVRNLSQMRKMSIALAI FT RRRDPCTNDS" XX CO join(AACY024077728.1:1..920) // ID EP498615; SV 1; linear; genomic DNA; CON; ENV; 864 BP. XX AC EP498615; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550318 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-864 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-864 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-864 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-864 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; d1c0a124a238873454140ba3c5e5ea6b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..864 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(154..>864) FT /locus_tag="GOS_264260" FT CDS complement(154..>864) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264260" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686286002; CAM_CL_1209" FT /inference="protein motif:Pfam (release 17):PF00590.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00096" FT /protein_id="EBB25427.1" FT /translation="GKLFKKYGINSKLIANHKFNEKKNLSKVIKLLKENLIISLISDAG FT TPGISDPGSILVRECVNNNISITALPGPSAVATAVAISGFSEKFFFYGFFPDKLKKLEE FT DLKILSQLNSSLVFFVSSKKFNKIINQLKMNFSGRKILICREMTKIYEEFIRKDIDQLD FT ENDVKQKGELTIVVSEKLGNKKNSQKLSESDKRNIRKMIDKYSIKEITNLISLNKKISK FT KEIYNYCLILKNEN" XX CO join(AACY024077729.1:1..864) // ID EP498616; SV 1; linear; genomic DNA; CON; ENV; 822 BP. XX AC EP498616; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550320 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-822 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-822 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-822 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-822 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f6766ce79b0202accf28df9a10f8fc8c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..822 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..583 FT /locus_tag="GOS_264262" FT CDS <1..583 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264262" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686595326; CAM_CL_1246" FT /inference="protein motif:Pfam (release 17):PF00478.12" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01302" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01303" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01304" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01305" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01306" FT /protein_id="EBB25425.1" FT /translation="GIGPGSICTTRVVAGAGMPQITAITDVANQLKGTDTCIISDGGIR FT YSGDIAKAIAAGANSIMLGSLFAGTEESPGEIELYQGRSFKSYRGMGSLGAMAQQHGSK FT DRYFQSDVEEPEKLVPEGIEGRVPYKGKLSKIIEQLVGGLRQSMGYTGCKDITELQTKT FT EFVRITDSGKREGHVHDVSITKEAPNYSVD" FT gene 590..>822 FT /locus_tag="GOS_264268" FT CDS 590..>822 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264268" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686595328; CAM_CL_34" FT /inference="protein motif:Pfam (release 17):PF00117.14" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00888" FT /protein_id="EBB25426.1" FT /translation="MQDRILILDFGSQYTQLIARRVREAGVYSEIYVGDIGIDAIESFQ FT PSGLILSGGPESAFIDDAPRPSKEIYSIGLPIL" XX CO join(AACY024077730.1:1..822) // ID EP498617; SV 1; linear; genomic DNA; CON; ENV; 989 BP. XX AC EP498617; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550322 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-989 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-989 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-989 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-989 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a29e9c25f028aaf5e88a47d5cffc4baf. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..989 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077731.1:1..989) // ID EP498618; SV 1; linear; genomic DNA; CON; ENV; 935 BP. XX AC EP498618; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550325 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-935 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-935 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-935 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-935 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; d749673670ff6557627362a563810bf0. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..935 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077732.1:1..935) // ID EP498619; SV 1; linear; genomic DNA; CON; ENV; 860 BP. XX AC EP498619; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550327 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-860 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-860 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-860 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-860 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 3f782adccabb362be688da9d2239bd1a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..860 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..389) FT /locus_tag="GOS_264271" FT CDS complement(<1..389) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264271" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687025302; CAM_CL_8768" FT /protein_id="EBB25424.1" FT /translation="MFDYNFMKNLICAITQPHYLPWKGYFNLINRVDLFIYLDDVKYIK FT REWKNRNKIRKSFSSNDYKWISIPIDKVNQNKYLNKCKVYDDLNWRVEHLNQINQVYNK FT APYFNLYFENISKIISDKNLIFFRR" FT gene complement(400..>860) FT /locus_tag="GOS_264270" FT CDS complement(400..>860) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264270" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687025300; CAM_CL_1655" FT /inference="protein motif:Pfam (release 17):PF03102.4" FT /protein_id="EBB25423.1" FT /translation="LKLVNAVAETKLPIIASVGMASEIEIDKFVKIVSKNNTPYILLHC FT VSSYPLEKKFSYLENIHTLKNRYGCPVGHSDHTYGIEIPSLAVACGASIIEKHFTDNIK FT LRQSDNFFSVTSDEVMEIKQNTKRIFSFMHNKNEKTEDYMRDFKKYID" XX CO join(AACY024077733.1:1..860) // ID EP498620; SV 1; linear; genomic DNA; CON; ENV; 890 BP. XX AC EP498620; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550330 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-890 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-890 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-890 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-890 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 7e819d952f1b830bd6a38eeaacf9aa17. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..890 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..739) FT /locus_tag="GOS_264272" FT CDS complement(<1..739) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264272" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686535496; CAM_CL_5240" FT /inference="protein motif:Pfam (release 17):PF07690.3" FT /protein_id="EBB25422.1" FT /translation="MYIHWPMSTSTNNKEGDPILFWGCFIALITTAFAFITRAFLVNTP FT DFWPKDFGFDSVQAGELFGAGIWPFAISIIIFSLIIDRIGYKVAMIFSFVCYVIYSIFA FT LKAYGMVQGLSGDELIAAQKSAFGTLKTGSIILGLGNGTVEAFINPVVATMYKKEKTKW FT LNILHAGWPGGLVIGGLLTIALGTQAAEDWRILVYLIAGPAIVFLVMLMGREFPQNERV FT ASGVSYREMLAEFGVIGAAIASFL" XX CO join(AACY024077734.1:1..890) // ID EP498621; SV 1; linear; genomic DNA; CON; ENV; 829 BP. XX AC EP498621; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550333 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-829 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-829 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-829 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-829 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 2a604ca794d2555a97cb64d06863bc1e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..829 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..651) FT /locus_tag="GOS_264273" FT CDS complement(<1..651) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264273" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686297356; CAM_CL_197" FT /inference="protein motif:Pfam (release 17):PF00012.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01991" FT /protein_id="EBB25421.1" FT /translation="MSKIIGIDLGTTNSCVAIMEGSQAKVLENAEGARTTPSVVAFTEE FT KEKLIGQPAKRQAVTNPENTIFAVKRLIGRNFDDPTVKKDIEAAPFKIVNSEKGDAWIE FT SKGEKYSPSQISAFILQKMKETAEKYLGQAVTKAVITVPAYFNDAQRQATKDAGKIAGL FT EVLRIINEPTAASLAYGLDKKQNKKIAVYDLGGGTFDVSILELGDGVFEVKSTN" XX CO join(AACY024077735.1:1..829) // ID EP498622; SV 1; linear; genomic DNA; CON; ENV; 845 BP. XX AC EP498622; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550335 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-845 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-845 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-845 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-845 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c0c9d12a60157c6a1f9206f1e82e4d19. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..845 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 64..585 FT /locus_tag="GOS_264276" FT CDS 64..585 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264276" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687086304; CAM_CL_212" FT /protein_id="EBB25420.1" FT /translation="MKSIKIIITSLVILFIFQAQLFAEIRYVDFKYVLNESKAGKEAQI FT YLKKKLDNGIKDLKAREKSIQEEEKKIIQQKKVISAEEYKKQVKALREKVSSLQTQRNN FT LLDTVAKQRSKARAELLKTLNPIIKNYMKENTVRLVLEKKSILLADENLNITKEITSLL FT NKKLKSIKLN" FT gene 576..>845 FT /locus_tag="GOS_264275" FT CDS 576..>845 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264275" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687086306; CAM_CL_1152" FT /inference="protein motif:Pfam (release 17):PF04613.2" FT /protein_id="EBB25419.1" FT /translation="MKLICLMKLPVFFKKEKSIPINKLFPKVKSNIKINDVATLSKSKK FT FDLTFFDSIRYKSFAINTKASFCITTEKLEKFLPIHTQKIIVKKV" XX CO join(AACY024077736.1:1..845) // ID EP498623; SV 1; linear; genomic DNA; CON; ENV; 826 BP. XX AC EP498623; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550337 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-826 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-826 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-826 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-826 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; bddfb3e51382a0fa4233dc7c9258c7a1. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..826 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(17..259) FT /locus_tag="GOS_264277" FT CDS complement(17..259) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264277" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687096932; CAM_CL_2227" FT /protein_id="EBB25417.1" FT /translation="MLERLYSRIDMVESKKKKTLTISTSFDKKKLSETNFRRGEKKVFI FT PEKKRFSRNTTKSGNFINQSTHKLNPNKKNLQESL" FT gene complement(231..>826) FT /locus_tag="GOS_264278" FT CDS complement(231..>826) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264278" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687096928; CAM_CL_3598" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01953" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01954" FT /protein_id="EBB25418.1" FT /translation="NLSKAIGRRGQNVRLASKLINYEIDILTDKEDSERRQAEFKDRSQ FT NFIKNLEVDETLGQLLVSENFQTIDEIAQSKIEDIGKIEGIEDSTAGELITRAKEYLQK FT EKIEISNKLKELGVEDSLINLKGMTQGMLVVLGEQNIKKLKDFAELSSDELIGGMDEIK FT GKRIKINGYLEDFALTRDEADNLIMSARKIVFED" XX CO join(AACY024077737.1:1..826) // ID EP498624; SV 1; linear; genomic DNA; CON; ENV; 795 BP. XX AC EP498624; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550339 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-795 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-795 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-795 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-795 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; de095eec7c828e7a391e7cb6b7a37dfa. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..795 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..375 FT /locus_tag="GOS_264280" FT CDS <1..375 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264280" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687226174; CAM_CL_8714" FT /inference="protein motif:Pfam (release 17):PF02130.6" FT /protein_id="EBB25415.1" FT /translation="KKINLNIFSKSKSINFSIRLTGNNEIRNLNKKFRKKNKTTDVLSF FT PYYDPSETRIKLKLNKTIYLGDIVINLYKIDKRKIKFESEFNKLWVHGLVHLLGYKHYK FT NKDFFEMMKIENKIIKQLKC" FT gene 363..>795 FT /locus_tag="GOS_264281" FT CDS 363..>795 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264281" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687226172; CAM_CL_688" FT /protein_id="EBB25416.1" FT /translation="MKMLKFFNRRFFILFIFPLFLGSITVLGFNPFNLLFVNAFSMSML FT FYLVFYVKKKTQSSYRKKPFLKNLFFLGTSYGFGFFLFGLYWITYSLTFDPSFKFLIPF FT ALIFIPLFLSLFFSLPIILIGRFVEFKISSIILISILFSI" XX CO join(AACY024077738.1:1..795) // ID EP498625; SV 1; linear; genomic DNA; CON; ENV; 940 BP. XX AC EP498625; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550341 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-940 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-940 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-940 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-940 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 22321302d56132083321f5b908952f6f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..940 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 38..634 FT /locus_tag="GOS_264282" FT CDS 38..634 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264282" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687216254; CAM_CL_3350" FT /inference="protein motif:Pfam (release 17):PF00528.10" FT /protein_id="EBB25413.1" FT /translation="MSFVLSLIIGGISGYYGGWIDSLLQMFTDAIRTVPPIPLFMCLAA FT FAPLEWSSELRFFFISCLLGLISWPTLARRVRTHLLSERSQEYILAAKLCGASSTHIIG FT RHLLPSFTSYIIVDLVISFPYMLLSETALSFIGLGLREPVNSLGVLLQNATKADVLLNY FT QWYFIPVFFLVVLILTFVYVGDGLRDAADPHKINK" FT gene 631..>940 FT /locus_tag="GOS_264283" FT CDS 631..>940 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264283" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687216256; CAM_CL_2568" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02211" FT /protein_id="EBB25414.1" FT /translation="MSHLLEVKNLDVKFDTDEGRITAVENISLSVDEGEVLGIVGESGS FT GKSVTAKSIMQLNPGNTSYNEDAQIILDNENVLKFTSKQDLKKIRGGKVSMIFQEPMA" XX CO join(AACY024077739.1:1..940) // ID EP498626; SV 1; linear; genomic DNA; CON; ENV; 900 BP. XX AC EP498626; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550343 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-900 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-900 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-900 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-900 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 42a025962e0bd280ebd30b91dd6fc5fc. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..900 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..588) FT /locus_tag="GOS_264284" FT CDS complement(<1..588) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264284" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686215758; CAM_CL_4701" FT /protein_id="EBB25412.1" FT /translation="MSFGTMVIINTIAALLIKYRLKNGLFMIRQTLSFIGKTFLGSSVI FT LTAKAIFDSRLRGPVSNIQDQKIDKWCSNIRQDGVCMVDNFLPTHECVNLRKEIDFLMN FT LYLDSVQLDEHEADQRLFLGGTAPGQIGSIYGDPRLATCASAFLGIGAENLATIAGRLN FT MIPGNHGSGGGWHRDSFTNQFKAIIYLSDVGKI" XX CO join(AACY024077740.1:1..900) // ID EP498627; SV 1; linear; genomic DNA; CON; ENV; 889 BP. XX AC EP498627; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550345 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-889 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-889 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-889 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-889 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 1221b87b5d2e247deed5813552ec9d05. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..889 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(158..>889) FT /locus_tag="GOS_264285" FT CDS complement(158..>889) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264285" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687066980; CAM_CL_1187" FT /inference="protein motif:Pfam (release 17):PF00562.15" FT /inference="protein motif:Pfam (release 17):PF04560.7" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02013" FT /protein_id="EBB25411.1" FT /translation="GIMKLAKVYVAKKRKLKVGDKMAGRHGNKGIVARIVRQEDMPFLE FT DGTPVDIVLNPLGVPSRMNIGQIYETVLGWAGMNLGKKFSTPIFDGATIDEINSFTDEA FT GVPKYGNTYLFDGGTGEKFDQPATVGVIYMLKLGHMVEDKMHSRSIGPYSLITQQPLGG FT KAQFGGQRFGEMEVWALEAYGASSTLQEILTIKSDDVIGRAKAYESIVKGERMPDAGLP FT ESFNVLMHELKGLGLDIRLEE" XX CO join(AACY024077741.1:1..889) // ID EP498628; SV 1; linear; genomic DNA; CON; ENV; 957 BP. XX AC EP498628; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550347 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-957 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-957 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-957 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-957 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 26b93e6bc5e551d7cdf363c027ecf740. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..957 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>957) FT /locus_tag="GOS_264288" FT CDS complement(<6..>957) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264288" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687075524; CAM_CL_13350386" FT /protein_id="EBB25410.1" FT /translation="LSLCLVIVVFFLPSLVQDDKEVLPNQAIEEKTILIPNQEILAQKP FT IAEALLSELLIKIESLKLQGILFWGMGEWEDVLIMQQQGDSAFIEQQYDVSAERYREAL FT QLLSDMEISIPDVLANALESGQSSILNGDKDDAIANFEIALAIDGNNLDAKQGLDRALK FT LDQVLERTQRGETEFGLGSYELAIQSFEDALSIDPNWEPAINGLNQAKKSYADNLFQES FT LSKGYRSLNDESFNDAKILFEQALSIRPNSKEALQALDELELKRIASLTKSLKYKGLIA FT EVNEEWNQAKGFYEEILVIDPNLEEVKESLSRVESR" XX CO join(AACY024077742.1:1..957) // ID EP498629; SV 1; linear; genomic DNA; CON; ENV; 934 BP. XX AC EP498629; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550349 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-934 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-934 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-934 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-934 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 21c71b84a1beaeaad511e3c1549a24b4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..934 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..848 FT /locus_tag="GOS_264289" FT CDS <1..848 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264289" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686266138; CAM_CL_1495" FT /inference="protein motif:Pfam (release 17):PF01842.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00656" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00657" FT /protein_id="EBB25409.1" FT /translation="FTVTDQDLPAALQITDRVAEAIAAAGVTHNPDVAKVSVVGMGMVH FT AEGVAATMFDALSAAGINVHMITTSEIKISVLVDRQNAQKSVEAAHKAFGLDGLADESP FT ATGSLPVQKSDPLEVVRRLEGMEDLAIEDCQLDMSQALVTFLDLPDTPGVAAAVFNEVG FT RAGLNVDMIVQSFPRNGRAEISFTVPALDRQRAISAATTIAQTRGAETTDVPEVAKLSI FT TGVGIRSHAGVADKLFAPLADAGINIDLISTSEVRVNVLVAAEHGRRSLGILRTAFGLD FT " XX CO join(AACY024077743.1:1..934) // ID EP498630; SV 1; linear; genomic DNA; CON; ENV; 932 BP. XX AC EP498630; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550351 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-932 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-932 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-932 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-932 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 4e5f0fc95ec4a66ab6b4709baceddbe1. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..932 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..556 FT /locus_tag="GOS_264292" FT CDS <1..556 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264292" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686246274; CAM_CL_2386" FT /inference="protein motif:Pfam (release 17):PF00271.17" FT /inference="protein motif:Pfam (release 17):PF02151.7" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00631" FT /protein_id="EBB25407.1" FT /translation="IERVKILRDLRLGDFDVLVGINLLREGLDLPEVSLVAILDADKEG FT FLRSKSSLVQTAGRAARHEEGKVILYADKITDSMKYLIDETERRRQIQMDYNKKNNITP FT KTVKKSVEEIMQSTRVAESYRESDIEIKRDIATDKFLNEDKKIVVEMIREEMLEAAENL FT EFEKAANLRDEMNKLEKEIKL" FT gene 553..>932 FT /locus_tag="GOS_264295" FT CDS 553..>932 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264295" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686246276; CAM_CL_3065" FT /inference="protein motif:Pfam (release 17):PF00158.15" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01817" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01818" FT /protein_id="EBB25408.1" FT /translation="MNNGDIMNIDLIKQKTGIVGESDAINQVLEMIAQVSNVDISVLIN FT GESGTGKELVSKALHLGSKRSSSELVIVNCGAIPEGIIESELFGHKKGAYTDASDSRKG FT YFETANKGTFFLMKLVICQLKL" XX CO join(AACY024077744.1:1..932) // ID EP498631; SV 1; linear; genomic DNA; CON; ENV; 1053 BP. XX AC EP498631; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550353 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1053 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1053 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1053 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1053 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b546d2d00db989b62d6fd67d4d637186. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1053 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..974) FT /locus_tag="GOS_264298" FT CDS complement(<1..974) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264298" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686576468; CAM_CL_390" FT /inference="protein motif:Pfam (release 17):PF02684.5" FT /protein_id="EBB25406.1" FT /translation="MKKIFILTGEPSGDKLASTVIGVLKKINQNIEYLSVGGEHLQSLG FT IRSIYDLKEITYLGFTNVILNIFKINKKINSTVKAINEYNPDVLFTVDSPDFTLRVAEK FT VKKLNSKIKTVHYVAPQVWVWREGRVKKLKNFIDHILLLFKFEKKYFEKENVSCEFVGH FT PLLQNKERAKIDINQVIGKNKALISVFPGSRKSEINILMPILLDFIRLMNQKYSDMTYV FT FHSTKEYSELIQSFMNESSLSNCEVISDNKIKSHILHKSIFAVAKSGTISLEISNAKIP FT SVILYKMGFINFLIVKSLVKTKYANIINFAANEEVIPELLQSN" XX CO join(AACY024077745.1:1..1053) // ID EP498632; SV 1; linear; genomic DNA; CON; ENV; 886 BP. XX AC EP498632; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550355 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-886 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-886 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-886 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-886 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 86608e601fdbe127ca3e49e0954f46b6. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..886 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..696 FT /locus_tag="GOS_264299" FT CDS <1..696 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264299" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686136728; CAM_CL_4860" FT /protein_id="EBB25405.1" FT /translation="NVTKFDTGDGPNLEFTEEEYNTPVVKLVEMTESADIEPVSSASSI FT PDESDVQNPEPIIPSIPSSPTSALESVPTPAPAPAVQSEPVSQATPSPSVPAVPTIPLV FT PEVPAIPEIPTIPDVPAIPTIPTATKPIPQQAGIWPWPQSEEWDDSTIRKMLREAMESA FT KAGNIDDSKRTLVSLGPHLGGRIDLIFHIGVLLKKFGQDDVMRRMIEAARIQHPESPDV FT VKAVQHLLS" XX CO join(AACY024077746.1:1..886) // ID EP498633; SV 1; linear; genomic DNA; CON; ENV; 929 BP. XX AC EP498633; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550357 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-929 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-929 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-929 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-929 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f34d0fab4251fa36632c5824c773aa2a. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..929 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>927 FT /locus_tag="GOS_264300" FT CDS <1..>927 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264300" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686695204; CAM_CL_2325" FT /inference="protein motif:Pfam (release 17):PF00456.10" FT /protein_id="EBB25404.1" FT /translation="EAFTEGLSSYPHPRLMPDYWEYPSVSMGLGAMTAIRQARFNRYLH FT NRGLVDTSESTTWYFMGDGESDEPESLSELTLASRENLDNIVMVVNCNLQRLDGPVRGN FT SKIVQELAARFTGAGWNVIKCLWGSKWDALFAKDRDGLLAARLEALADGDEQRIMTDEG FT SVIRAELFNSPELAELVSDLSDEDLEDLAGNVGGHDPIKVFAAYTAARAHKGRPTVILA FT RTIKGWGLGPSFAGRNSTHGKKKADQSVLQYMRDELGLTFTDTQLEKLPYLQPANYPEE FT VEYLLERREKLGGFCPERRTPTVDLELP" XX CO join(AACY024077747.1:1..929) // ID EP498634; SV 1; linear; genomic DNA; CON; ENV; 771 BP. XX AC EP498634; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550359 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-771 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-771 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-771 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-771 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 9ecf548134dcff824723d4b26ba41c7f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..771 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..355) FT /locus_tag="GOS_264301" FT CDS complement(<1..355) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264301" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686315324; CAM_CL_7039" FT /protein_id="EBB25403.1" FT /translation="MLYEHPVFRIMGDCSINIEFGDESSIPLNFQILSLDKSIESNPIN FT GLIETNPQVRSLGLVFDPTITTISYIRDYIEDLLKSKQKVLSLPSRRLIIPALYDDPWS FT RKCAKSFDVQNNIE" XX CO join(AACY024077748.1:1..771) // ID EP498635; SV 1; linear; genomic DNA; CON; ENV; 875 BP. XX AC EP498635; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550361 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-875 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-875 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-875 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-875 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; bc6e65127a75d5635e47521fb16e4e0b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..875 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(487..864) FT /locus_tag="GOS_264302" FT CDS complement(487..864) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264302" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686395222; CAM_CL_11294932" FT /protein_id="EBB25402.1" FT /translation="MKSSGEKKIATFFEQIKKDIFPEWDRKNEWRVKNLKTYKDDSKHL FT NSDYLGRCDSTGKIIYLNLDPEDWKIEMLMVHEICHAHKGCKSHGDQWRKKMKVAADKC FT ESIGNFRLADQIRHEIENYTS" XX CO join(AACY024077749.1:1..875) // ID EP498636; SV 1; linear; genomic DNA; CON; ENV; 835 BP. XX AC EP498636; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550363 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-835 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-835 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-835 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-835 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 35bc9708c4a267fda2b57848c034249c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..835 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>835) FT /locus_tag="GOS_264303" FT CDS complement(<6..>835) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264303" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686675500; CAM_CL_1937" FT /protein_id="EBB25401.1" FT /translation="PGAYRSVCVELQVHHLAVCAIVKSGILNDLEQGALLGFDTGSKAT FT SRTGGHEAAIAFKTLRALVDNWLRDATDHHNEYADALLSQIHRWLFSPNSSLRDPSLKN FT LVELCMKKVFTLLLAELRKLQVEVVYADMRRIIIATGKHDLASASSCVEGLKTALHQRE FT LFSWLQLDRINQWHSLLFKGPFDYAGIKASTLPGESQWVDSLAPNDSQLDPLAMGDGEG FT ALDMHWNIARFLPEAIQDHFHAIVGEFLLLPWKHEKDEDDPLHGRTPGKFGRER" XX CO join(AACY024077750.1:1..835) // ID EP498637; SV 1; linear; genomic DNA; CON; ENV; 926 BP. XX AC EP498637; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550365 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-926 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-926 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-926 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-926 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 26aecd3affaf2fe5327f6a5bfa54f819. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..926 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077751.1:1..926) // ID EP498638; SV 1; linear; genomic DNA; CON; ENV; 919 BP. XX AC EP498638; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550367 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-919 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-919 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-919 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-919 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f812033d709fe5b289d89bfe7571ce14. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..919 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..312 FT /locus_tag="GOS_264304" FT CDS <1..312 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264304" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686585450; CAM_CL_11674325" FT /protein_id="EBB25399.1" FT /translation="KLYIAYECKNEQEKHYFWVADKLISDNAETPLQIGLAFFGTLLGT FT SIANKSSSFEDASDEIIPLIEQRKKIISSSKKIQVSLAASCALLLTIYVVGFWIVTIL" FT gene 418..873 FT /locus_tag="GOS_264305" FT CDS 418..873 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264305" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686585448; CAM_CL_7589" FT /protein_id="EBB25400.1" FT /translation="MMHIKTKIPPPLVALIFGFLINYTKDIFPKIEIRNENIFGSFMII FT IGLIIILSAIILFKKYQTTITPLNPSNATRLITDGIYKFSRNPMYLGLLLVLFGTSIIL FT NPIGGLFLIPLFILYLNLFQIIPEENAMVDLFKGEFLEYKENVRRWI" XX CO join(AACY024077752.1:1..919) // ID EP498639; SV 1; linear; genomic DNA; CON; ENV; 912 BP. XX AC EP498639; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550369 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-912 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-912 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-912 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-912 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0cefb9961b9c369dfaf4f301d581a5ee. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..912 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 111..>912 FT /locus_tag="GOS_264306" FT CDS 111..>912 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264306" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686385440; CAM_CL_336" FT /inference="protein motif:Pfam (release 17):PF00512.12" FT /protein_id="EBB25398.1" FT /translation="MEVDIMLTALRTESTRLLHLTIIALQIFSVAQVIWWFIDQQTFAQ FT QTSNQVKMLYSYNIVAAQKLADLGVAEGEVATLFPYTQFLDGRARLAEGTIEALENERR FT RHVNQYAWESGFFLLVLASCIAVLWRGLNNETNIRRRQDNFLAMVSHQFKTPLASLQLS FT IETMLIRGLSTERFQQLSQRMLGDLRRMENMVSKILDSARFDRGRVYLSKERLNLSEAV FT RHVTSNIEELALRENIKILIDVSPELEIFADPMAVDTVLRNLAEN" XX CO join(AACY024077753.1:1..912) // ID EP498640; SV 1; linear; genomic DNA; CON; ENV; 1009 BP. XX AC EP498640; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550371 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1009 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1009 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1009 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1009 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0c93a23c0a359d589750ea92a42a8f36. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1009 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..570 FT /locus_tag="GOS_264307" FT CDS <1..570 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264307" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686825674; CAM_CL_170" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02282" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02283" FT /protein_id="EBB25396.1" FT /translation="FYRKQLFAALKIIDDKMIPSNNLIGSWGGAVGMTQMIPTTFLESA FT YDWDGGGIDIWNSYLDAFASTANYLTSIDKNPWLNDSTWGREVLPPKNINEFFEKIQQN FT NAKGCGAVKSRSIPKFLNEWSKLGFLTINGQPLPSRNNLEARLIAPDGMNGRMFLVYPN FT YKNLLYYNCSSYYAVSVGLLSDKISN" FT gene 551..>1009 FT /locus_tag="GOS_264309" FT CDS 551..>1009 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264309" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686825676; CAM_CL_823" FT /inference="protein motif:Pfam (release 17):PF03330.6" FT /protein_id="EBB25397.1" FT /translation="MIKLVTSFFLIIFLVSCKIQQTDQILDILPDKETIKKAVKIPENK FT VLKKSTNELNQKKSNLIKYHIGDPYYIEGVEYIPEENYNYDEIGLASFYGKELHKRKTI FT NNDFNNVTELLGRHKTLPVPSIVKVTNLDNGLSLTIKINDRHDDNSTLI" XX CO join(AACY024077754.1:1..1009) // ID EP498641; SV 1; linear; genomic DNA; CON; ENV; 826 BP. XX AC EP498641; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550373 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-826 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-826 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-826 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-826 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; de19dd5bac5debde046a4e73dddc849e. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..826 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<4..>826) FT /locus_tag="GOS_264310" FT CDS complement(<4..>826) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264310" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686645302; CAM_CL_812" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00678" FT /protein_id="EBB25395.1" FT /translation="LAFNFISKILKIIDNNNYNNHISLLYKNSHPNIRYITRSYDESKD FT KTSEYISIDQIRGLNNFINQSSFNNIPKFIIFDSADNFNKNSSNSLLKILEEPSDNTYF FT ILISHQLSNILPTIRSRCIKFYFNKPSKDIFYEIIKNQNVDINNANIDFLYLLSNGSPG FT TAIKISTDKMNDLYNSIIDITIPNKNDLSKKIFDLSEYVSNFTNDEYKVFLMLLRFILI FT NIIKNNLGILSEFTTLNNENFITKLISFEILEFIDNNEKDLFIYNLDKKNIL" XX CO join(AACY024077755.1:1..826) // ID EP498642; SV 1; linear; genomic DNA; CON; ENV; 947 BP. XX AC EP498642; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550375 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-947 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-947 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-947 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-947 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f033ba6de4ebb9d2059195adefa27692. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..947 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..648 FT /locus_tag="GOS_264311" FT CDS <1..648 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264311" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686436290; CAM_CL_5240" FT /protein_id="EBB25394.1" FT /translation="FRRCYVLFFWEGLPLATMLGVAGERYPQSGSVAMGALGAAGMICV FT GQIAGPRIGTQQGFEMSQHLEQTAPDTFSRYATTDVTQSWGYEYRALDAAKLNAANATE FT LVDGKPQSTAAITNAALIPDSEKNTLVKNASTDFKAVQDSYLFGGRQALRLTSYIPGAM FT AIGFLGMLIYFRAIGGYKVIHLDGTEESHEGATGAEVPDGTGPEDTPAASEY" XX CO join(AACY024077756.1:1..947) // ID EP498643; SV 1; linear; genomic DNA; CON; ENV; 961 BP. XX AC EP498643; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550377 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-961 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-961 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-961 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-961 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 00868109fa8385beb1ec42e2f442c441. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..961 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>961) FT /locus_tag="GOS_264312" FT CDS complement(<6..>961) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264312" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686367128; CAM_CL_425" FT /protein_id="EBB25393.1" FT /translation="ELVGKPITEAQFDEAAGKKDACYHKVKARYDVWPSAYASGALVKC FT RKVGAANWGNKSKKEGVNEASMELKKLEDAIKMFQKKIKKQGRVTNARDEDHLKNLIKV FT YKQMGGKGVKEGLGDKISKKLKKHKGTKIKEGEFLDSLFPKAKVDKAIKIAKKMSGNMT FT GAVKAIEKFFPGMSKNTKVQDALRQANESITEARGTCWVGYQQVGMKKKGGKMVPNCVK FT ETTEIFYEEDGKGYGYTFEYINDGKLDEAEYQGRKVKLGKVMQGDTKKFKVYVKNPKGN FT VVKVNFGQGGGAKGGTMRIRKSNPKARKSFRARHNCD" XX CO join(AACY024077757.1:1..961) // ID EP498644; SV 1; linear; genomic DNA; CON; ENV; 932 BP. XX AC EP498644; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550379 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-932 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-932 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-932 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-932 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 88addc677365c2d4705b95135d1ecf17. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..932 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>932 FT /locus_tag="GOS_264313" FT CDS <1..>932 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264313" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687146592; CAM_CL_3161" FT /protein_id="EBB25392.1" FT /translation="YKRNLSKDSETKESHRPIIISFNGGPGSGSLWMHIGYTGPRVLKI FT DDEGFPIQPYGMKTNPYSIIDTADIVFVCPVNTGYSRMIADNNGDYPKRETFFGINADI FT KYLATWINTFISRKNRWESPKYIIGESYGGTRVMGLSYELQSSHWMYLNGVIMVSPADY FT KLLEFDDGQEDAIDSSLHLPYYAATAWYHKMLDQEIQSMDLLAFLPQVEEFTINKLIPA FT IAKGGFISDKERDEIAEKYSYYSGLDKDFILDYNLDIPNYAFWKELLRKSDGLTLGRLD FT SRYRGIDRTNAGSSPDTNIELNSWNHSFT" XX CO join(AACY024077758.1:1..932) // ID EP498645; SV 1; linear; genomic DNA; CON; ENV; 783 BP. XX AC EP498645; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550381 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-783 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-783 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-783 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-783 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 54207e2db60bffb349771830c581ca13. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..783 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 174..>783 FT /locus_tag="GOS_264314" FT CDS 174..>783 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264314" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687136320; CAM_CL_5298" FT /inference="protein motif:Pfam (release 17):PF00753.15" FT /protein_id="EBB25391.1" FT /translation="MIILYMKITFLGTGTSQGIPVIGSTHPVCLSDNPKDKRLRTSALI FT QLDNKNIVIDCGPDFRAQMLNSACDRVDAIFFTHEHNDHVSGLDDIRPFYFRQGNIPIY FT AGIRVIDALKNRFGYIFKTEGNIPGTPNVKINEINDNFMFNENEIILLHAFHGKLPIYG FT FRIGNTAYFTDVKSIPESEFKKLNNLDLLVINALRKEEHY" XX CO join(AACY024077759.1:1..783) // ID EP498646; SV 1; linear; genomic DNA; CON; ENV; 886 BP. XX AC EP498646; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550383 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-886 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-886 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-886 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-886 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c73f723eca50fce1d7c46d29268f97c6. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..886 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 553..>886 FT /locus_tag="GOS_264315" FT CDS 553..>886 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264315" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687255248; CAM_CL_4802" FT /inference="protein motif:Pfam (release 17):PF01168.9" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00492" FT /protein_id="EBB25390.1" FT /translation="MITNMQGPVAVIHLDRLLKNYDLIKNHLNQKRIMVVVKANAYGHG FT SVECAKALEKHGCDSFAVFSVEEGVELRENGIASDILVFSKMNNTSLELSNKYELIINA FT SSLSDIN" XX CO join(AACY024077760.1:1..886) // ID EP498647; SV 1; linear; genomic DNA; CON; ENV; 841 BP. XX AC EP498647; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550385 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-841 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-841 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-841 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-841 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 47c9af159c562406a088760bd458ad46. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..841 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..554) FT /locus_tag="GOS_264317" FT CDS complement(<1..554) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264317" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686993464; CAM_CL_6571" FT /protein_id="EBB25389.1" FT /translation="MAEEATKQEMVVDATPEKKAFMTKRSTHEERIKKDEEELKEMIEA FT QKGETESVEAKAENEEEPKGAEEKTFKKRYGDLRRHTQEKEKQFQKQLDELKSQLSQAT FT KKEMKLPKSDEDIDAWAKEYPDVAKIVETIAMKKAKEQSDSLEKRIKEIKEFNEETVKE FT RAKVELMKIHPDFDQIRDSDD" XX CO join(AACY024077761.1:1..841) // ID EP498648; SV 1; linear; genomic DNA; CON; ENV; 904 BP. XX AC EP498648; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550387 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-904 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-904 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-904 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-904 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 00377ccdb704399c57b12f4d4d6fadff. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..904 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..281 FT /locus_tag="GOS_264318" FT CDS <1..281 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264318" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686986272; CAM_CL_565" FT /protein_id="EBB25388.1" FT /translation="VTNNMDEAALQAELMKDFRAPQQEQPQPQPPAGTDPSDPTGSGGG FT TIGTGIAPTPQEQGFTGRSQVGQQQPQADTQPTQDVGEQPQTNQPLQ" XX CO join(AACY024077762.1:1..904) // ID EP498649; SV 1; linear; genomic DNA; CON; ENV; 882 BP. XX AC EP498649; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550389 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-882 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-882 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-882 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-882 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 904ac7f65feca00bd0c245e6c2962cf9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..882 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>880 FT /locus_tag="GOS_264319" FT CDS <1..>880 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264319" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686425254; CAM_CL_159" FT /inference="protein motif:Pfam (release 17):PF00664.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02204" FT /protein_id="EBB25387.1" FT /translation="HVQHALRQDAYNHIQTREIEFFENHRMGETMAMLNDDVNQIERFL FT NTGFNEILQLGVLFAFSSVVLLGVSWQLALVGLLPLPIVLWGSLFYQKTISPRYKRVRE FT AVGSLSSRLENNIAGILVIKSFTAESFESRRVKAASGEYQEANRHAIRLSSVYVPMIRM FT AIAIGFGGVLLLGSYWVLEDKGILTVGELVLFSMLIQRMLWPLTRMGITLDEFERAKAS FT ARRTFGLLETPSKIIDPPDAQSLPKPVRGEIRFEGIRFNYLRGNTILSGLDFTLSQGET FT IGIAGATGAGKS" XX CO join(AACY024077763.1:1..882) // ID EP498650; SV 1; linear; genomic DNA; CON; ENV; 813 BP. XX AC EP498650; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550391 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-813 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-813 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-813 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-813 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8a12769695166aed8bb92ef39499a8c8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..813 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(133..450) FT /locus_tag="GOS_264321" FT CDS complement(133..450) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264321" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686945496; CAM_CL_18137" FT /inference="protein motif:Pfam (release 17):PF04023.4" FT /protein_id="EBB25385.1" FT /translation="METRFSKLQSGDTGNVVGFTEGSASYRSKLLAMGLVPGVPFHVVR FT KAPLGDPVGIRVNGFHLCLRRKEAEMLRLKGYLQTLDTSFPCRGCSDINSTRPKYFRWK FT N" FT gene 614..>813 FT /locus_tag="GOS_264322" FT CDS 614..>813 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264322" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686945502; CAM_CL_7611" FT /protein_id="EBB25386.1" FT /translation="MKGFKQPSLLDLGEPKIDFDFPGIGRIDLGEGAWVEHLPNWLKGH FT QDLFETLRETTGWRKQERQMY" XX CO join(AACY024077764.1:1..813) // ID EP498651; SV 1; linear; genomic DNA; CON; ENV; 891 BP. XX AC EP498651; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550393 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-891 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-891 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-891 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-891 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 3acc61ce8d9b65200b3a408a91f85219. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..891 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 397..693 FT /locus_tag="GOS_264323" FT CDS 397..693 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264323" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687126010; CAM_CL_10302" FT /inference="protein motif:Pfam (release 17):PF00034.9" FT /protein_id="EBB25384.1" FT /translation="MPKTNKNIGSKNSRIWIAGIFVITLFGGYLYQQGSSPLNALANAP FT SPAEIEQGKKLFAQNCSSCHGVEGIGQNPESPNGGMLDEGGYLAPALNGTGHA" XX CO join(AACY024077765.1:1..891) // ID EP498652; SV 1; linear; genomic DNA; CON; ENV; 976 BP. XX AC EP498652; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550396 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-976 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-976 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-976 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-976 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a4eaa55506218cf7b2e120fb37c358a4. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..976 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..438 FT /locus_tag="GOS_264324" FT CDS <1..438 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264324" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686745544; CAM_CL_1336" FT /inference="protein motif:Pfam (release 17):PF00291.13" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00263" FT /protein_id="EBB25382.1" FT /translation="ALGIFSGFVDTDADLVGVEPAGGAAVFRGTPGVVHGSLSYLMQDE FT WGQVLEAESISAGLDYPGIGPEHAHLADIGRARYEKVSDSEVVDAFQLLSRTEGIIPAL FT EPAHALAWMSRARRELSGKTVLLNLSGRGDKDATQMMELLG" FT gene 426..>976 FT /locus_tag="GOS_264326" FT CDS 426..>976 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264326" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686745542; CAM_CL_6103" FT /inference="protein motif:Pfam (release 17):PF00290.10" FT /protein_id="EBB25383.1" FT /translation="MAGMSKSPLRIEESLRKRIGGGGKCLVPYITGGFEGYVEAIYAAA FT EAGADAIEIGIPFSDPVMDGPTIQKANDVVLAQKISPLDILQEIRDLDIGIPLAVMTYY FT NIVYRFGLERFANALSESGISGAILPDLPLNEAGAWVDAASANGTETILLAAPTTTDER FT LEALCGQSKGFVYAVGLLGIT" XX CO join(AACY024077766.1:1..976) // ID EP498653; SV 1; linear; genomic DNA; CON; ENV; 962 BP. XX AC EP498653; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550398 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-962 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-962 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-962 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-962 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 53ff78324d3f7d8374d7bab272993086. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..962 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 153..962 FT /locus_tag="GOS_264327" FT CDS 153..962 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264327" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686515350; CAM_CL_10802" FT /inference="protein motif:Pfam (release 17):PF00348.7" FT /protein_id="EBB25381.1" FT /translation="MQSFNSLILDIRKHFNDSLRKIQINDNPKYLYDPIRYSIQTKGKR FT FRPVLLHLVGRANNVKPDILMTMSLAIELLHNFTLIHDDIMDNDSMRRGKKTIHEKWDL FT STAILSGDGIYTISQIILSQIPDLKSNVFNYFNKTTLEICEGQALDKEFENNYTISEDM FT YISMIEKKTGALIGASSALPLIFKHKPHHIVKVYEKFGRCIGKAFQIQDDILEITGDYI FT KMGKSLGSDILLGKQTIMAIKANNNYPSEWEDLIFNSEKNFLTNNIF" XX CO join(AACY024077767.1:1..962) // ID EP498654; SV 1; linear; genomic DNA; CON; ENV; 523 BP. XX AC EP498654; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550400 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-523 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-523 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-523 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-523 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 47b9f8eb94f8687ec2e03e444f89e21d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..523 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077768.1:1..523) // ID EP498655; SV 1; linear; genomic DNA; CON; ENV; 660 BP. XX AC EP498655; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550402 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-660 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-660 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-660 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-660 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e5737db3a539e2ed12d8478629083bc2. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..660 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077769.1:1..660) // ID EP498656; SV 1; linear; genomic DNA; CON; ENV; 781 BP. XX AC EP498656; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550404 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-781 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-781 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-781 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-781 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; f7680b7d001328d21cf25a7ebaaa7f90. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..781 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..775 FT /locus_tag="GOS_264328" FT CDS <1..775 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264328" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686725558; CAM_CL_293" FT /inference="protein motif:Pfam (release 17):PF00623.10" FT /inference="protein motif:Pfam (release 17):PF04983.6" FT /protein_id="EBB25380.1" FT /translation="QQLELANTIKLAKRMVDREEPEVWDILDEVIREHPVMLNRAPTLH FT RLGIQAFEPVLVEGKAIQLHPLVCKAYNADFDGDQMAVHVPLTLEAQLECRALMMATNN FT ILSPSNGKPIIDPSQDVVLGLYYMSREKVNDLGEGRIMSSPDEVNRAYYSRTVGLQAKI FT KVRLKPNKLDDEPSEIVETTTGRTLLYELLPEGMSFDLVNKTLDSKQISSLIDFVYRKA FT GLKRTVIFADRLMYLGYEFSTKSGSSIGIDDFCHS" XX CO join(AACY024077770.1:1..781) // ID EP498657; SV 1; linear; genomic DNA; CON; ENV; 809 BP. XX AC EP498657; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550409 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-809 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-809 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-809 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-809 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 365519b5dc0ee51e0caaf51dd70a61cd. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..809 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 207..>809 FT /locus_tag="GOS_264330" FT CDS 207..>809 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264330" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686625510; CAM_CL_293" FT /inference="protein motif:Pfam (release 17):PF02861.7" FT /protein_id="EBB25379.1" FT /translation="MASLADAASLGSGARLAPGARRLSRRSLVARPPSRRSPPTRAMFD FT RFDGDAVTAVKDGMDEAKKLRLSEIKTEHLLLACAKVRDDTSAALHKAGATEDAIRRAC FT ARRAGVSELELMNPFSNNKVADGLVPLGEDIKRLFETVATEAEAAAGDRLVSTREMVNA FT MIADTTCGAHAVLAEDLDVDLGNLRGAVNGEKKELVGA" XX CO join(AACY024077771.1:1..809) // ID EP498658; SV 1; linear; genomic DNA; CON; ENV; 979 BP. XX AC EP498658; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550427 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-979 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-979 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-979 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-979 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0915447924a22e9f0053a9ee1a72bca3. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..979 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..973 FT /locus_tag="GOS_264331" FT CDS <1..973 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264331" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686656164; CAM_CL_1507" FT /inference="protein motif:Pfam (release 17):PF01326.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01828" FT /protein_id="EBB25378.1" FT /translation="ILNIGLNDENVEHLSEVFNDEKFALDSYRRLIQMYGNVVLGIEHT FT RFEAVLNNKKRIDNIDSDSDFNPQQLKWIIDAYKNTVERFSNSPFPQDPHEQLTGSIEA FT VFKSWLNKRAATYRKINNIPDTLGTGATIQTMVFGNLNEKSGTGVAFTRFPSTGKNELY FT GEYLMNAQGEDVVAGLRTPFPIGKHEKNKELSLEEENPKLFKDIKDIANKLENHYKEVQ FT DIEFTIENDILYLLQTRKAKRTAQASVKIAVDMHKEKKVTKKEALNMVDADSITAILHP FT QFIDEQKKKIFGKGLNASPGAAFGEIVFDADKAEEEANKGEM" XX CO join(AACY024077772.1:1..979) // ID EP498659; SV 1; linear; genomic DNA; CON; ENV; 954 BP. XX AC EP498659; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550434 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-954 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-954 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-954 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-954 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 6259da70ee8207997c3954d2701bac71. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..954 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..256) FT /locus_tag="GOS_264333" FT CDS complement(<1..256) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264333" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686795684; CAM_CL_2377" FT /inference="protein motif:Pfam (release 17):PF02739.5" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00593" FT /protein_id="EBB25376.1" FT /translation="MGKEKLLLVDGSSYLYRAFHALPDLRSSDGRPTGAIYGVLNMLQK FT LIKSERPDYLSVVFDTPAKTFRHDIFPDYKANRQKTPEDL" FT gene 410..>954 FT /locus_tag="GOS_264335" FT CDS 410..>954 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264335" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686795680; CAM_CL_4040" FT /protein_id="EBB25377.1" FT /translation="MIQSNWFDRKLRKMMMKEFTWENSKDEFESKNLIGLDLETTGLNR FT NIEYERPTSAAILETNLNFESPEIIVDDKCRLPYHILPDAGALNVTNINPLELMDEPLS FT LFDLVQKIARYLETSYGKALVTYNGAAYDLIILRHSFFAHLFDPYLLVKAAEDRLHIDL FT YSLAQTIYCFFPNRIAFH" XX CO join(AACY024077773.1:1..954) // ID EP498660; SV 1; linear; genomic DNA; CON; ENV; 927 BP. XX AC EP498660; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550436 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-927 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-927 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-927 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-927 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 937cb11904dbfe5a07298d05b6c423db. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..927 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..>926 FT /locus_tag="GOS_264336" FT CDS <1..>926 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264336" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687155240; CAM_CL_1723" FT /inference="protein motif:Pfam (release 17):PF01551.9" FT /protein_id="EBB25375.1" FT /translation="EISLESVDYEFSIPEETKMVVKSGDTFYSTLISYGVSSILINKMA FT LDKDLREFIRFRVNDRIYIRADGREVEMKRFSDDDYFIDVLTIKDGDYKFSRKRDSLEK FT LVQYREFVITDSLYASGKKSGVPDSILGDLIYIFGWDIDYAYDIRNGDVVRILYEDIYS FT NSNGKLIATGDILAAEFVNRGEKIAVIRFSQRGRKDYYTTDSTNVRKAFLRTPIEFARI FT SSHYNPNRKHPVLNTIRAHKGTDYAAKSGTEVVATGDGIVKEAKFSRSYGNYIDIVHYN FT KYLTRYAHLKDFAKGIKKGSRVIQGQT" XX CO join(AACY024077774.1:1..927) // ID EP498661; SV 1; linear; genomic DNA; CON; ENV; 991 BP. XX AC EP498661; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550440 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-991 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-991 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-991 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-991 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; c0448b27e12191328bd14f5263995273. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..991 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>991) FT /locus_tag="GOS_264337" FT CDS complement(<5..>991) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264337" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687383466; CAM_CL_13507920" FT /protein_id="EBB25374.1" FT /translation="LRFRIVTFVLPCMKMAEGGEDAKFFIEMMRGEWGSLSRSMDVNTF FT WVTSWMSMFAQLAKHDIKGEIGWGEVCGDIYATALRILELPIGGVEGRCSFGRNVSHRV FT VLTFKSHLETPRRVRIMAKLLIYRAMHDSAVIGNIEKIIDYIEHFYHPSSGGSYTTNLA FT HFMRYMIKYTTKFLSYDDRTAPPEVVTRMMAAFTRMTDKAVFSKSSDLRLHASIGIGRL FT AYIDPERTLPSVMSRFEEALSHETATRQLVPAMNCLAICIRQMMLLPLNTVFQDASEAY FT VNVNEFLASALTATLPGIDVNDSSKTCATLRLFCMVITNLPVLIDVGE" XX CO join(AACY024077775.1:1..991) // ID EP498662; SV 1; linear; genomic DNA; CON; ENV; 921 BP. XX AC EP498662; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550454 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-921 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-921 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-921 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-921 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a392c20006bfc53d3645ac1d745849b9. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..921 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<6..>921) FT /locus_tag="GOS_264338" FT CDS complement(<6..>921) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264338" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686406234; CAM_CL_11050801" FT /protein_id="EBB25373.1" FT /translation="VCFCVWALFTGIFAMIAAFFYSEKWFTRSMLLGATWLLFSFGRFQ FT EQGFLNQFVTPDDNGERWTDLLNDGIGMWIWLGITFFSFVLVFYVSTHQKYGNKMNRTI FT GDLGQARKFWNANWCSILIGLAFITALAIRVVWNVLPAMNALGTGGWDLTGGSDPWYMK FT RAIDYVIAEHAHFIFDADRAYPIGDINPRPPLYTWSLALGGLILSPILGISAENAVWWS FT VGALPAIYGALIIFPVAGMAREVFGKGAGVLAAWLIAFMPGHVSHTTFALADHDAFVLL FT FATVGFYYYIQAMKNTNEDRIFLI" XX CO join(AACY024077776.1:1..921) // ID EP498663; SV 1; linear; genomic DNA; CON; ENV; 917 BP. XX AC EP498663; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550457 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-917 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-917 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-917 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-917 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 75d1bd498d25997fa2160c29ea8451ac. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..917 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..434) FT /locus_tag="GOS_264339" FT CDS complement(<1..434) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264339" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686685336; CAM_CL_6597" FT /protein_id="EBB25371.1" FT /translation="MNFFSLYISYKLRGENFMDHSFLQGNDFVGITFWIVSIGMWAATL FT FFFYEGMRVSAKWRTSIVVAALITFIAAVHYMYMREYWVTYQESPIVYRYIDWVLTVPL FT QMIEFFLILVAVGAAVSANSFWRLLVGTLVMIIGGYLGEAG" FT gene 534..>917 FT /locus_tag="GOS_264340" FT CDS 534..>917 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264340" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686685338; CAM_CL_1153" FT /inference="protein motif:Pfam (release 17):PF04073.4" FT /protein_id="EBB25372.1" FT /translation="MKLQRTMTNLLNKKSVLRVKEFLDSNNLNIKLIVLDETARTANDA FT AKSLNKKVGAIVKSLLFKNIENNEYYLCLVSGDQYMSIKKLSDITEGKIVKANADECKE FT YTGFSIGGVSPFAHKTKTTNIFID" XX CO join(AACY024077777.1:1..917) // ID EP498664; SV 1; linear; genomic DNA; CON; ENV; 991 BP. XX AC EP498664; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550464 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-991 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-991 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-991 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-991 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 99ee1ca1390ffc45352822a8f299fa6c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..991 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..226 FT /locus_tag="GOS_264341" FT CDS <1..226 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264341" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686735234; CAM_CL_5043" FT /protein_id="EBB25368.1" FT /translation="SNAIKLVEFLLTPQSQEHFTNNTFEFPMIDGVSPSPLVVNNLGLD FT FKQDMKTKLASYGKNQAAAVEVMTAAGWK" FT gene 210..401 FT /locus_tag="GOS_264342" FT CDS 210..401 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264342" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686735236; CAM_CL_17488" FT /protein_id="EBB25369.1" FT /translation="MLVGSNIVKVKKKFMSNIDLNKSSKACSPCYLECKKIDKRINDRK FT LSKIKNKEVPHILKVFNY" FT gene 493..>991 FT /locus_tag="GOS_264343" FT CDS 493..>991 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264343" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686735232; CAM_CL_1374" FT /protein_id="EBB25370.1" FT /translation="MMRINFWHISSFFISVFVIIPILTVFSSFFENTSNYYQVLKDTFL FT LEYILNSLILLLSVLTFTFLIGTGSAYLVSFYEFPFSNFFKWALILSFAVPPYIYAYSL FT TAFFENYGTAYTILKNLFGDANYNQSIPKFDGLFGVILSISFFLYAYVYILARASFLYQ FT PQN" XX CO join(AACY024077778.1:1..991) // ID EP498665; SV 1; linear; genomic DNA; CON; ENV; 693 BP. XX AC EP498665; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550499 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-693 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-693 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-693 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-693 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 1a4081d7f594d002c9ac46f346e2b19c. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..693 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..543) FT /locus_tag="GOS_264344" FT CDS complement(<1..543) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264344" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686846798; CAM_CL_183" FT /inference="protein motif:Pfam (release 17):PF00892.8" FT /protein_id="EBB25367.1" FT /translation="MTFIRNLPGPLLIFLGALSLSFGGLIVKSFEGATLWQILFWRSLF FT FSLTVLAFLIISYKGKTIESFYKSGLPGFVGGIILSFGFCGYVFAMYNTTVANTNFIIS FT LQILFLAIFGYFFLKEKISLITLFSIVIAMTGVLLMVGNSLSPGELSGNLAAFTMPITF FT AVLIMIVRKFPSVDMVPA" XX CO join(AACY024077779.1:1..693) // ID EP498666; SV 1; linear; genomic DNA; CON; ENV; 974 BP. XX AC EP498666; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550501 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-974 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-974 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-974 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-974 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; bc811a705549d7eb99e8f0f0b7c93861. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..974 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 89..>974 FT /locus_tag="GOS_264345" FT CDS 89..>974 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264345" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687355484; CAM_CL_1239" FT /inference="protein motif:Pfam (release 17):PF00501.14" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01217" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01733" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01923" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02188" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02262" FT /protein_id="EBB25366.1" FT /translation="MKIQKHWKDNALVTPKDYEDLYTRSINDNDGFWKKQGERLDWIKK FT YSKIKDIKYSSTDVNIKWYYDGELNVSENCIDRHAKNNPNKIAIIWEGDDPKNTLKITY FT KELLLNVSRTANALKELGIQKGDRVTIYLTMIPELAYTMLACARIGAVHSIIFGGFSSE FT SIAGRITDCKSEFVITADEGIRGGKTIPLKKIMDEALKNSSNIKKCIVVKRTGNIVNME FT KERDVYLDDILKNVSDHCEIATMNAEDPLFILYTSGSTGKPKGVLHTSGGYLVYASMTH FT EYIFNYKENDIYWC" XX CO join(AACY024077780.1:1..974) // ID EP498667; SV 1; linear; genomic DNA; CON; ENV; 834 BP. XX AC EP498667; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550507 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-834 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-834 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-834 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-834 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; cf47dd9c998b4145b6279ca8bf95280f. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..834 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..336 FT /locus_tag="GOS_264351" FT CDS <1..336 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264351" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686556240; CAM_CL_244" FT /inference="protein motif:Pfam (release 17):PF00036.18" FT /protein_id="EBB25365.1" FT /translation="SGDGLIDVNEFIAALLDWEKIEKTSEYPKWVERAFKILDKDSSGQ FT IDAEEVAQLIFEETTESNDSVRASVVKECIKEADIDGNGKIDMAEFASLLQADPMDDLD FT QYDSREL" XX CO join(AACY024077781.1:1..834) // ID EP498668; SV 1; linear; genomic DNA; CON; ENV; 894 BP. XX AC EP498668; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550511 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-894 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-894 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-894 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-894 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 80c4422c1f8dda21d30aea6242fe765d. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..894 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(110..>894) FT /locus_tag="GOS_264352" FT CDS complement(110..>894) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264352" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686925472; CAM_CL_49" FT /inference="protein motif:Pfam (release 17):PF00106.13" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01829" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01830" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01831" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01832" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01963" FT /protein_id="EBB25364.1" FT /translation="MKKGIFDLSGKVSLITGGNGGIGLGMAEGLAECGSNVAIWGRNKD FT KNEKSRELLADYDVKVLTYEVDVSNEKEVIDSVNLVLNDFGRIDSVFANAGMNVFGGSF FT EDMNTEAYRKVLSVNLDGVFFTLRETTRHMVERAKDGDVGGSVIGVASLAGIEGAAKTQ FT PYSASKGGIISMMKGIAVEHARYGIRANTILPGWIATDMTEINQNNQKFTDKVISRVPM FT RRWGEPKDFSGIAAYLASDASAYHSGDMFVVDGGYAIF" XX CO join(AACY024077782.1:1..894) // ID EP498669; SV 1; linear; genomic DNA; CON; ENV; 1823 BP. XX AC EP498669; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550515 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1823 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1823 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1823 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1823 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; ae3930274dd1dc418829ac16bd7f6d56. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1823 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..272) FT /locus_tag="GOS_264362" FT CDS complement(<1..272) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264362" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686637418; CAM_CL_1155" FT /inference="protein motif:Pfam (release 17):PF01765.8" FT /protein_id="EBB25363.1" FT /translation="MRSNNMSFDESDLRRRMNGALNSLKEEFIGLRTGRASTALLDSLK FT VDAYGSKMPINQVASLSTPEARLILIQVWDQSMVNSIEKSIRESDL" FT gene complement(273..887) FT /locus_tag="GOS_264359" FT CDS complement(273..887) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264359" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686637414; CAM_CL_1289" FT /inference="protein motif:Pfam (release 17):PF00696.15" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02075" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR02076" FT /protein_id="EBB25362.1" FT /translation="MTKEIQTVVKLGVEVCLVVGGGNIFRGISAEEAGIERTTGDYMGM FT LATVMNALAIQNSLELIGIDTRVQSALPITSVCETYIRRRAERHLEKGRVIIFAAGTGN FT PYFTTDTAAALRASEMKCNAMFKATNVDGVYSSDPKKNKNATRYKKLKYMDVLGKDLKV FT MDAAAISLARENNVPVIVFSIHEIGAFSKVVSGDGKFTIIQ" FT gene complement(1053..>1823) FT /locus_tag="GOS_264358" FT CDS complement(1053..>1823) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264358" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686637412; CAM_CL_1222" FT /inference="protein motif:Pfam (release 17):PF00889.8" FT /protein_id="EBB25361.1" FT /translation="SGRVASEGLIGMYIEDNLGSIVEVNSETDFVARNIEFQEFVSSVA FT KISLNNKGDLDDVLKSKYLDFDKSVQEVLTDIIAKIGENMSLRRTNVLSVSNGIIAGYI FT HNSVNDNLGKIGVLVSLESNADKSALKKFGKELAMHIAATSPTSVSVNDLSPDIVERER FT SVLIDQAMSSGKPEEIAKKMVEGRLKKFYSEVVLLEQTFVMDGETKVIDAINKLSKELG FT SDIQIKNFTRFNLGEGIEKDEKNFADEVAEQLSN" XX CO join(AACY024077783.1:1..1823) // ID EP498670; SV 1; linear; genomic DNA; CON; ENV; 793 BP. XX AC EP498670; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550522 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-793 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-793 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-793 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-793 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a13dad7739d71387c230fd433a75814b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..793 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..289) FT /locus_tag="GOS_264364" FT CDS complement(<1..289) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264364" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686805994; CAM_CL_14481066" FT /protein_id="EBB25360.1" FT /translation="MISMTDTNDYSEITLSYKFGIPFGNWKLSPLLKQTNTTYRVVNTD FT GVKKTSDKKNVSIELMYPLTGWMILSLAPQFEQGNSNTSAAYQKNLVSLKM" FT gene complement(273..>793) FT /locus_tag="GOS_264363" FT CDS complement(273..>793) FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264363" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686805992; CAM_CL_14481066" FT /protein_id="EBB25359.1" FT /translation="SQESTKTSAYKGSLTLLSTLNKRFDHQSRTALNALIMGDAYQEKT FT FKDYSVFFKQISWDWYENFYFFPFELKTSLGMNTVSMGDSTETSNKRDPIRKDFKQYSE FT DQFFSLTGTTKHSENNSWKINLERKNKTNHDDSGQNGYAFGMSVEYQIKLYDWNHTFKL FT VDSINDFHD" XX CO join(AACY024077784.1:1..793) // ID EP498671; SV 1; linear; genomic DNA; CON; ENV; 812 BP. XX AC EP498671; XX PR Project:PRJNA13694; XX DT 12-APR-2007 (Rel. 91, Created) DT 12-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550524 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-812 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-812 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-812 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-812 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 830de3e12f07dad2523a3eb4a62b74a6. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..812 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" XX CO join(AACY024077785.1:1..812) // ID EP498672; SV 1; linear; genomic DNA; CON; ENV; 863 BP. XX AC EP498672; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550526 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-863 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-863 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-863 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-863 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a2740c8bc9ee22d769237f3ec16b88e5. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..863 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<5..>863) FT /locus_tag="GOS_264365" FT CDS complement(<5..>863) FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264365" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687376530; CAM_CL_14619484" FT /inference="protein motif:Pfam (release 17):PF00271.17" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01970" FT /protein_id="EBB25358.1" FT /translation="AEAEEMAARQLEKISEAEDERVDVEVSEDEDDEDGDEDEDEDSEV FT DSELEDMEMKLEGTSTKAVSPRRLRASSRVRALRRAVALRNARTGESSMKVGVNTKSFR FT GNEAKEVSELTIQLLIEVAKHIAALETDAGRQGSILCFLPGWDEIKSAMSILEETTDPD FT LYEKLLVIPLHSTIPQEEQQKVFIPAKEGVVKVILATNIAESSVTINDVLAVVDSGLVR FT EMSWNAESGMSTMQTVTTSRASATQRTGRAGRVAPGSCYRIYSHGTLHAMAERPTPEIQ FT RTALE" XX CO join(AACY024077786.1:1..863) // ID EP498673; SV 1; linear; genomic DNA; CON; ENV; 886 BP. XX AC EP498673; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550537 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-886 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-886 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-886 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-886 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 0abe76bb54f80281f6aa19018c0d1b00. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..886 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 22..636 FT /locus_tag="GOS_264367" FT CDS 22..636 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264367" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687036250; CAM_CL_11112125" FT /protein_id="EBB25356.1" FT /translation="MLWGAGCASHPPVLPQIPVEGETNMGFSFAAENVIPVIWWRHGLN FT QYTDVGLKLGIPLSGTGIDINRVLMKKDRRWDVLNLAYSYSPNSSFDLTYYMFKGSKRK FT GQLNPYNIGWTGARVMIIPDGRFENPGPGNDRSIRFGFLFGRRFGYRWGFEAGYFHDPR FT AGFDPKNEDYPHTDNKWPTQFSRGTGLSMQLFMYLGPTKKS" FT gene 644..>886 FT /locus_tag="GOS_264368" FT CDS 644..>886 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264368" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687036252; CAM_CL_11017086" FT /protein_id="EBB25357.1" FT /translation="MADQSLRSALLSKDKQACYKLVHSKLKGDDLVNTINDLIYISALV FT THNKDIITHPVCITNSIKNFIGDNKEAPSRVLLDFA" XX CO join(AACY024077787.1:1..886) // ID EP498674; SV 1; linear; genomic DNA; CON; ENV; 992 BP. XX AC EP498674; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550545 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-992 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-992 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-992 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-992 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; e302c3c80f9d116062309e89787327b8. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..992 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..357 FT /locus_tag="GOS_264369" FT CDS <1..357 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264369" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687043864; CAM_CL_1235" FT /protein_id="EBB25354.1" FT /translation="TLNEFLLLESIYELQSKQKTISQNELSIYSGIDTAVVSVVIKNLE FT RKKFIKRITDIDNRKKSIEMLSMGSEQFNIIYPKVITEEQNIFSKLQNEKNNFTNSLRL FT ILGKKLRIKVDNSI" FT gene 354..>992 FT /locus_tag="GOS_264370" FT CDS 354..>992 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264370" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687043862; CAM_CL_3569" FT /inference="protein motif:Pfam (release 17):PF01921.7" FT /protein_id="EBB25355.1" FT /translation="MKFISQKDCENLKAWPFIEALKIIDRFGGIKNFKTPEKDYILFET FT GYGPSGLPHIGTFGEVVRTSMVRHALSKIIDCKTKLFTFSDDMDGLRKIPDNIPNKEKL FT IEFIGKPLTSVPDPFEKFESFGHHNNNKLCNFLDEFNFDYEFVSSTEKYRSGFFNSTIL FT EILQNYEEIISIILPTLRKERQETYSPFLPISPISGDVLQVKIEEYRPKD" XX CO join(AACY024077788.1:1..992) // ID EP498675; SV 1; linear; genomic DNA; CON; ENV; 1698 BP. XX AC EP498675; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550547 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-1698 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-1698 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-1698 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-1698 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; a01062cbc66a5f21c791069bab4d799b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..1698 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..818) FT /locus_tag="GOS_264373" FT CDS complement(<1..818) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264373" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687234386; CAM_CL_897" FT /inference="protein motif:Pfam (release 17):PF00109.14" FT /protein_id="EBB25352.1" FT /translation="MMKPRRVVVTGLGALTPIGNNISSFWQGLINGKSGAAPITYFDAS FT KFKTHFACEIKNFDPLNHFDRKEARKYDRFAQYALVSTEEAIKDSKLDLEKIDKDRVGV FT IWGAGIGGLETFQNEVLNFASGDGTPRFNPFFIPKMISDIAPGLISIKYGFMGPNFSTV FT SACASAANAIIDSLNYIRMGHADIIVSGGSEAAITIAGIGGFNSMHALSTKNDDPKSAS FT RPFDKNRDGFVLGEGAGSLILEEYEHAKSRGSKIYAELIGGGLSADAYHMT" FT gene complement(826..1062) FT /locus_tag="GOS_264374" FT CDS complement(826..1062) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264374" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687234392; CAM_CL_14604" FT /inference="protein motif:Pfam (release 17):PF00550.11" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00517" FT /protein_id="EBB25353.1" FT /translation="MSDTSSRVKAIIVDKLGVDENEVVVDANFTNDLGADSLDTVELIM FT EFEKEFDIQIPDDQAENISTVGQAIQYIEEQLS" FT gene 1210..>1698 FT /locus_tag="GOS_264371" FT CDS 1210..>1698 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264371" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687234388; CAM_CL_569" FT /inference="protein motif:Pfam (release 17):PF00551.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR00639" FT /protein_id="EBB25351.1" FT /translation="MSEKKNKKIIIFASGDGTNAEEIIEYFKNNNKVNIQLILTNNSNA FT GVLKRAKKHGIPANFYNNEAFENKIVFEILNSLNPNLIVLAGFIRKIPNKIISRFPNKI FT INIHPALLPSHGGKGMFGIEVHKSVIRSNDSKTGVTIHYVNSNYDEGKIIFQKSLKVDP FT " XX CO join(AACY024077789.1:1..1698) // ID EP498676; SV 1; linear; genomic DNA; CON; ENV; 995 BP. XX AC EP498676; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550550 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-995 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-995 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-995 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-995 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 269141e22b83feee01a443a152516794. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..995 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..241 FT /locus_tag="GOS_264376" FT CDS <1..241 FT /codon_start=2 FT /transl_table=11 FT /locus_tag="GOS_264376" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687247144; CAM_CL_10479" FT /protein_id="EBB25349.1" FT /translation="LQGKGLQEMQARNAEIQGEMNRYLDIFKRHNLTKLAAAKPGLIEP FT RANKATKEVFDGIEEDSRNIDDLDDGIQLQSGTN" FT gene 129..542 FT /locus_tag="GOS_264377" FT CDS 129..542 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264377" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096687247142; CAM_CL_12237" FT /protein_id="EBB25350.1" FT /translation="MNHEQIKLLRRYSMESKRIVAILTTLMMVSSCSLVPTKKEVQVTT FT KAIERTIIQPVMPREIDLKEPYWYVVSDKNIDEFLARIEKDQGEVVFFAMSVPDYELMA FT YNMQELKRYINELKEVVVYYRKVTVPPKKDDES" XX CO join(AACY024077790.1:1..995) // ID EP498677; SV 1; linear; genomic DNA; CON; ENV; 978 BP. XX AC EP498677; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550562 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-978 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-978 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-978 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-978 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; b818a0385855e531f3f7c246f56984fa. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..978 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene <1..599 FT /locus_tag="GOS_264378" FT CDS <1..599 FT /codon_start=3 FT /transl_table=11 FT /locus_tag="GOS_264378" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686457256; CAM_CL_14189881" FT /protein_id="EBB25347.1" FT /translation="GYKVGNGLGSYTFLLRNTNSKINYSIYYEHYFDDLSGMKLKNLGD FT GIFGLMLEKNNNLFQYEYIDTTNQSGNQHPPGVDSYYWHQTYRFGWTNKGESLGNIFIS FT PLNNRKRIHHLSVKYHFKHFDMYIQSAKEKNYIPYNFKNNNEPIENSNSMINSNVFSGI FT ILSKEISSNIISLGYYFDNKNKSISNIMVSYQIQL" FT gene 557..>978 FT /locus_tag="GOS_264379" FT CDS 557..>978 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264379" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686457258; CAM_CL_4366" FT /inference="protein motif:Pfam (release 17):PF01063.8" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01121" FT /inference="protein motif:TIGRFAM (Version 4.1):TIGR01122" FT /protein_id="EBB25348.1" FT /translation="MYFKYYGKLSNTIMKSHTSVKNPLNDEIYININGALFKRNEAKIS FT VFDSGFLLGDGVWEGIRLHHSKLLFIDAHLDRLFNSAKGIDLKIDFTRNEIISEIFKVI FT DKNRMTNDVHIRLVVTRGDKITPYQNPKANIGRINYV" XX CO join(AACY024077791.1:1..978) // ID EP498678; SV 1; linear; genomic DNA; CON; ENV; 696 BP. XX AC EP498678; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550565 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-696 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-696 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-696 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-696 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 5b9327a5113037ba24c5cdbec6a86f4b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..696 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<4..>696) FT /locus_tag="GOS_264382" FT CDS complement(<4..>696) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264382" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686955952; CAM_CL_4325" FT /inference="protein motif:Pfam (release 17):PF00561.9" FT /protein_id="EBB25346.1" FT /translation="AASETTTRVSAFVDASSRWGETVFVSATTATGTYDVKCVDTGAGD FT EDEEMFILLHGFMGSSADWNAVARGLVAHGGARVVALDLPAHGETTLASSDASSEEAYS FT IEAMRDVVASVARALGCRPEKTRVVGYSMGARVALALDETIAEGFIAVGGSPGVCGDDA FT RRARAARDDDLADALRRADDVREFSEVWYRQGLFSTLVAHPRFGGVAGLAARRGTGADA FT RALAACVSA" XX CO join(AACY024077792.1:1..696) // ID EP498679; SV 1; linear; genomic DNA; CON; ENV; 881 BP. XX AC EP498679; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550569 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-881 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-881 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-881 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-881 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 8c917c4dba5dc4cb63af0112faaa0bae. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..881 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene 146..>881 FT /locus_tag="GOS_264383" FT CDS 146..>881 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264383" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686775962; CAM_CL_4887" FT /inference="protein motif:Pfam (release 17):PF04166.2" FT /protein_id="EBB25345.1" FT /translation="MKTIIYSPGDPAGIGPDLFLSLLNEDFFRFIKANVVCIGDQKLFA FT SRAKELGYSFEISTFTDINDVNEKVGCLEIMRCPDISSGRLNSINSEYVIKNLDFGIDA FT CMKSKGIGLVTGPISKENIVEGGYSFSGHTERIMEKTNSDDVLMLLASERLKVALATTH FT VPLNKVSESITTDLIINKVKILNQELKSKFNIEKPKISLLGLNPHAGEGGKLGKEEIEI FT IIPAVKELKASNVDVSMPLSADT" XX CO join(AACY024077793.1:1..881) // ID EP498680; SV 1; linear; genomic DNA; CON; ENV; 910 BP. XX AC EP498680; XX PR Project:PRJNA13694; XX DT 06-APR-2007 (Rel. 91, Created) DT 06-APR-2007 (Rel. 91, Last updated, Version 1) XX DE marine metagenome JCVI_SCAF_1096626550571 genomic scaffold, whole genome DE shotgun sequence. XX KW . XX OS marine metagenome OC unclassified sequences; metagenomes; ecological metagenomes. XX RN [1] RP 1-910 RX DOI; 10.1371/journal.pbio.0050016. RX PUBMED; 17355171. RA Yooseph S., Sutton G., Rusch D.B., Halpern A.L., Williamson S.J., RA Remington K., Eisen J.A., Heidelberg K.B., Manning G., Li W., RA Jaroszewski L., Cieplak P., Miller C.S., Li H., Mashiyama S.T., RA Joachimiak M.P., van Belle C., Chandonia J.M., Soergel D.A., Zhai Y., RA Natarajan K., Lee S., Raphael B.J., Bafna V., Friedman R., Brenner S.E., RA Godzik A., Eisenberg D., Dixon J.E., Taylor S.S., Strausberg R.L., RA Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: expanding the universe RT of protein families"; RL PLoS Biol. 5(3):e16-e16(2007). XX RN [2] RP 1-910 RX DOI; 10.1371/journal.pbio.0050017. RX PUBMED; 17355172. RA Kannan N., Taylor S.S., Zhai Y., Venter J.C., Manning G.; RT "Structural and functional diversity of the microbial kinome"; RL PLoS Biol. 5(3):e17-e17(2007). XX RN [3] RP 1-910 RX DOI; 10.1371/journal.pbio.0050077. RX PUBMED; 17355176. RA Rusch D.B., Halpern A.L., Sutton G., Heidelberg K.B., Williamson S., RA Yooseph S., Wu D., Eisen J.A., Hoffman J.M., Remington K., Beeson K., RA Tran B., Smith H., Baden-Tillson H., Stewart C., Thorpe J., Freeman J., RA Andrews-Pfannkoch C., Venter J.E., Li K., Kravitz S., Heidelberg J.F., RA Utterback T., Rogers Y.H., Falcon L.I., Souza V., Bonilla-Rosso G., RA Eguiarte L.E., Karl D.M., Sathyendranath S., Platt T., Bermingham E., RA Gallardo V., Tamayo-Castillo G., Ferrari M.R., Strausberg R.L., Nealson K., RA Friedman R., Frazier M., Venter J.C.; RT "The Sorcerer II Global Ocean Sampling expedition: northwest Atlantic RT through eastern tropical Pacific"; RL PLoS Biol. 5(3):e77-e77(2007). XX RN [4] RP 1-910 RG J. Craig Venter Institute RA ; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, RL USA XX DR MD5; 76803ce4a3fec10f89283e0f4551635b. DR ENA; AACY02000000; SET. DR ENA; AACY00000000; SET. DR BioSample; SAMN02954345. XX CC For complete environmental metadata relating to this record, CC background on the Global Ocean Sampling expedition, as well as CC additional analysis results, please visit the CAMERA website CC (http://camera.calit2.net). XX FH Key Location/Qualifiers FH FT source 1..910 FT /organism="marine metagenome" FT /environmental_sample FT /mol_type="genomic DNA" FT /isolation_source="isolated as part of a large dataset FT composed predominantly from surface water marine samples FT collected along a voyage from Eastern North American coast FT to the Eastern Pacific Ocean, including locations in the FT Sargasso Sea, Panama Canal, and the Galapagos Islands" FT /note="metagenomic" FT /db_xref="taxon:408172" FT gene complement(<1..423) FT /locus_tag="GOS_264384" FT CDS complement(<1..423) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264384" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686756080; CAM_CL_7047" FT /protein_id="EBB25343.1" FT /translation="MYSVMKVDFIFDFASPNAYCCHKVIPEIENRTGIKFNYIHCLLGG FT IFKITNNQAPMIQFSEIKNKLDYEGIEMERFMQKHNLDKFKMNSNFPITTVSLQRGALV FT AEKMNFVEEYRDKVLQAMWEDDINLGDQEVLFNFIKR" FT gene 475..>910 FT /locus_tag="GOS_264385" FT CDS 475..>910 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="GOS_264385" FT /product="hypothetical protein" FT /note="JCVI_ORF_1096686756078; CAM_CL_49" FT /inference="protein motif:Pfam (release 17):PF00106.13" FT /protein_id="EBB25344.1" FT /translation="MRDYSKFSAIIIGAGVSTGSAISRKFAEMGYHVVPVRRERNFPEL FT EKLTDSIKEAGHKATPFGVDARDEDAIAKLFQEVEENIAPIDVVVFNPGANVFFPIEET FT TARVYKKVWEMAAFAGFLTGREAAKYMKTRGHGSIFFTGCD" XX CO join(AACY024077794.1:1..910) // ID EP498681; SV 1; linear; genomic DNA